Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | SE859_RS03335 | Genome accession | NZ_CP138367 |
| Coordinates | 617984..618172 (+) | Length | 62 a.a. |
| NCBI ID | WP_000027835.1 | Uniprot ID | A0AAV3JNT7 |
| Organism | Streptococcus agalactiae strain R31-snf2-MTase2 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 609198..617942 | 617984..618172 | flank | 42 |
| IS/Tn | 617028..617528 | 617984..618172 | flank | 456 |
Gene organization within MGE regions
Location: 609198..618172
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SE859_RS03295 (SE859_03295) | - | 610577..610738 (-) | 162 | WP_079262691.1 | TM2 domain-containing protein | - |
| SE859_RS03300 (SE859_03300) | - | 611481..612758 (+) | 1278 | WP_000594357.1 | ABC transporter permease | - |
| SE859_RS03305 (SE859_03305) | - | 612768..613424 (+) | 657 | WP_000353149.1 | ABC transporter ATP-binding protein | - |
| SE859_RS03310 (SE859_03310) | - | 613424..614800 (+) | 1377 | WP_000594356.1 | ABC transporter permease | - |
| SE859_RS03315 (SE859_03315) | - | 614897..615550 (+) | 654 | WP_000699093.1 | response regulator transcription factor | - |
| SE859_RS03320 (SE859_03320) | - | 615547..616866 (+) | 1320 | WP_000734173.1 | HAMP domain-containing sensor histidine kinase | - |
| SE859_RS03325 (SE859_03325) | - | 616918..617564 (-) | 647 | Protein_575 | IS3 family transposase | - |
| SE859_RS03330 (SE859_03330) | - | 617742..617942 (+) | 201 | WP_000076708.1 | CsbD family protein | - |
| SE859_RS03335 (SE859_03335) | prx | 617984..618172 (+) | 189 | WP_000027835.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7180.25 Da Isoelectric Point: 4.7815
>NTDB_id=902245 SE859_RS03335 WP_000027835.1 617984..618172(+) (prx) [Streptococcus agalactiae strain R31-snf2-MTase2]
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
Nucleotide
Download Length: 189 bp
>NTDB_id=902245 SE859_RS03335 WP_000027835.1 617984..618172(+) (prx) [Streptococcus agalactiae strain R31-snf2-MTase2]
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
72.222 |
87.097 |
0.629 |
| prx | Streptococcus pyogenes MGAS8232 |
69.091 |
88.71 |
0.613 |
| prx | Streptococcus pyogenes MGAS315 |
66.667 |
87.097 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
64.516 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
61.818 |
88.71 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
74.359 |
62.903 |
0.468 |
| prx | Streptococcus pyogenes MGAS315 |
78.378 |
59.677 |
0.468 |