Detailed information
Overview
| Name | comC/comC1 | Type | Regulator |
| Locus tag | R4709_RS05460 | Genome accession | NZ_CP137102 |
| Coordinates | 1057421..1057546 (+) | Length | 41 a.a. |
| NCBI ID | WP_000799689.1 | Uniprot ID | P60242 |
| Organism | Streptococcus pneumoniae strain 16H3071-2 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1052421..1062546
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R4709_RS05435 | dnaA | 1052906..1054267 (-) | 1362 | WP_000660615.1 | chromosomal replication initiator protein DnaA | - |
| R4709_RS05440 | spo0J | 1054480..1055238 (-) | 759 | WP_000410383.1 | ParB/RepB/Spo0J family partition protein | Regulator |
| R4709_RS05445 | htrA | 1055296..1056477 (-) | 1182 | WP_000681601.1 | S1C family serine protease | Regulator |
| R4709_RS05450 | rlmH | 1056660..1057139 (+) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| R4709_RS05460 | comC/comC1 | 1057421..1057546 (+) | 126 | WP_000799689.1 | competence-stimulating peptide ComC | Regulator |
| R4709_RS05465 | comD/comD1 | 1057567..1058892 (+) | 1326 | WP_317802303.1 | competence system sensor histidine kinase ComD | Regulator |
| R4709_RS05470 | comE | 1058889..1059641 (+) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| R4709_RS05485 | - | 1059884..1060426 (-) | 543 | WP_001158266.1 | TetR/AcrR family transcriptional regulator | - |
| R4709_RS05490 | - | 1060554..1062207 (+) | 1654 | Protein_1083 | YhgE/Pip family protein | - |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4971.00 Da Isoelectric Point: 11.0775
>NTDB_id=895248 R4709_RS05460 WP_000799689.1 1057421..1057546(+) (comC/comC1) [Streptococcus pneumoniae strain 16H3071-2]
MKNTVKLEQFVALKEKDLQKIKGGEMRLSKFFRDFILQRKK
MKNTVKLEQFVALKEKDLQKIKGGEMRLSKFFRDFILQRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=895248 R4709_RS05460 WP_000799689.1 1057421..1057546(+) (comC/comC1) [Streptococcus pneumoniae strain 16H3071-2]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GTTGTCAAAATTCTTCCGTGATTTTATTTTACAAAGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GTTGTCAAAATTCTTCCGTGATTTTATTTTACAAAGAAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC1 | Streptococcus pneumoniae R6 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae G54 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae D39 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
100 |
100 |
1 |
| comC/comC2 | Streptococcus pneumoniae A66 |
80.488 |
100 |
0.805 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
80.488 |
100 |
0.805 |
| comC | Streptococcus mitis SK321 |
78.049 |
100 |
0.78 |
| comC | Streptococcus mitis NCTC 12261 |
74.074 |
65.854 |
0.488 |
| comC/blpC | Streptococcus mutans UA159 |
44.444 |
87.805 |
0.39 |