Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | R3J34_RS03035 | Genome accession | NZ_CP136975 |
| Coordinates | 703650..704096 (-) | Length | 148 a.a. |
| NCBI ID | WP_038210386.1 | Uniprot ID | A0AAW6HUM6 |
| Organism | Xylella fastidiosa subsp. multiplex strain CFBP8070 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 694426..717786 | 703650..704096 | within | 0 |
Gene organization within MGE regions
Location: 694426..717786
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R3J34_RS02980 (R3J34_02955) | - | 694468..695052 (+) | 585 | WP_004083991.1 | alpha-ketoglutarate-dependent dioxygenase AlkB | - |
| R3J34_RS02985 (R3J34_02960) | - | 695247..695888 (-) | 642 | WP_004083987.1 | ABC-type transport auxiliary lipoprotein family protein | - |
| R3J34_RS02990 (R3J34_02965) | - | 695885..696811 (-) | 927 | WP_004083985.1 | MlaD family protein | - |
| R3J34_RS02995 (R3J34_02970) | - | 696815..697645 (-) | 831 | WP_004083974.1 | ABC transporter ATP-binding protein | - |
| R3J34_RS03000 (R3J34_02975) | - | 697651..698769 (-) | 1119 | WP_004083972.1 | ABC transporter permease | - |
| R3J34_RS03005 (R3J34_02980) | - | 698885..700147 (+) | 1263 | WP_012337721.1 | threonine/serine exporter ThrE family protein | - |
| R3J34_RS03010 (R3J34_02985) | - | 700788..700994 (+) | 207 | WP_071869858.1 | hypothetical protein | - |
| R3J34_RS03015 (R3J34_02990) | - | 701058..701270 (+) | 213 | WP_228304324.1 | hypothetical protein | - |
| R3J34_RS03020 (R3J34_02995) | - | 701334..701543 (+) | 210 | WP_225621843.1 | hypothetical protein | - |
| R3J34_RS03025 (R3J34_03000) | xerC | 702184..703356 (-) | 1173 | WP_004083967.1 | tyrosine recombinase XerC | - |
| R3J34_RS03030 (R3J34_03005) | - | 703356..703628 (-) | 273 | WP_004083966.1 | hypothetical protein | - |
| R3J34_RS03035 (R3J34_03010) | ssb | 703650..704096 (-) | 447 | WP_038210386.1 | single-stranded DNA-binding protein | Machinery gene |
| R3J34_RS03040 (R3J34_03015) | - | 704080..704550 (-) | 471 | WP_071869857.1 | DUF5131 family protein | - |
| R3J34_RS03045 (R3J34_03020) | - | 704543..704773 (-) | 231 | WP_154415128.1 | hypothetical protein | - |
| R3J34_RS03050 (R3J34_03025) | - | 704773..705096 (-) | 324 | WP_038210382.1 | hypothetical protein | - |
| R3J34_RS03055 (R3J34_03030) | - | 705189..705722 (-) | 534 | WP_004086585.1 | pilin | - |
| R3J34_RS03060 (R3J34_03035) | - | 705855..706019 (-) | 165 | WP_238842262.1 | hypothetical protein | - |
| R3J34_RS03065 (R3J34_03040) | - | 706108..706386 (-) | 279 | WP_027700595.1 | hypothetical protein | - |
| R3J34_RS03070 (R3J34_03045) | - | 706383..706604 (-) | 222 | WP_021358638.1 | hypothetical protein | - |
| R3J34_RS03075 (R3J34_03050) | - | 706601..707050 (-) | 450 | WP_038210363.1 | hypothetical protein | - |
| R3J34_RS03080 (R3J34_03055) | - | 707050..707508 (-) | 459 | WP_027700592.1 | DUF1566 domain-containing protein | - |
| R3J34_RS03085 (R3J34_03060) | - | 707505..707846 (-) | 342 | WP_228762220.1 | hypothetical protein | - |
| R3J34_RS03090 (R3J34_03065) | - | 707992..708615 (+) | 624 | WP_154415131.1 | hypothetical protein | - |
| R3J34_RS03095 (R3J34_03070) | - | 708717..709118 (-) | 402 | WP_154415132.1 | hypothetical protein | - |
| R3J34_RS03100 (R3J34_03075) | - | 709117..709605 (+) | 489 | WP_238842264.1 | CHC2 zinc finger domain-containing protein | - |
| R3J34_RS03105 (R3J34_03080) | - | 709541..710185 (+) | 645 | WP_338400544.1 | terminase gpA endonuclease subunit | - |
| R3J34_RS03110 (R3J34_03085) | - | 710262..710498 (+) | 237 | WP_012337727.1 | hypothetical protein | - |
| R3J34_RS03115 (R3J34_03090) | - | 710495..711010 (+) | 516 | WP_004083947.1 | phage portal protein | - |
| R3J34_RS03120 (R3J34_03095) | - | 711127..711417 (+) | 291 | WP_076613257.1 | hypothetical protein | - |
| R3J34_RS03125 (R3J34_03100) | - | 711544..711972 (+) | 429 | WP_069107012.1 | hypothetical protein | - |
| R3J34_RS03130 (R3J34_03105) | - | 711969..712205 (+) | 237 | WP_154415134.1 | hypothetical protein | - |
| R3J34_RS03135 (R3J34_03110) | - | 712195..715020 (+) | 2826 | WP_375732359.1 | phage tail protein | - |
| R3J34_RS03140 (R3J34_03115) | - | 715013..715501 (+) | 489 | WP_228762574.1 | hypothetical protein | - |
| R3J34_RS03145 (R3J34_03120) | - | 715651..715929 (+) | 279 | WP_228762225.1 | hypothetical protein | - |
| R3J34_RS03150 (R3J34_03125) | - | 716029..716700 (+) | 672 | WP_375732360.1 | hypothetical protein | - |
| R3J34_RS03155 | - | 716881..717063 (-) | 183 | WP_027700048.1 | hypothetical protein | - |
| R3J34_RS03165 (R3J34_03140) | - | 717535..717786 (+) | 252 | WP_004086775.1 | Panacea domain-containing protein | - |
Sequence
Protein
Download Length: 148 a.a. Molecular weight: 16508.32 Da Isoelectric Point: 6.4865
>NTDB_id=893960 R3J34_RS03035 WP_038210386.1 703650..704096(-) (ssb) [Xylella fastidiosa subsp. multiplex strain CFBP8070]
MARGINKVILVGNLGNEPDIKYTQSGMTITSISLATSSGRKDREGNTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEG
TIRYDKFTGNDGQDRYVTEIIADQMHMLGGRGEGSSGITPQRQPAKVRNNDKAYAYAGDDFHDDDIPF
MARGINKVILVGNLGNEPDIKYTQSGMTITSISLATSSGRKDREGNTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEG
TIRYDKFTGNDGQDRYVTEIIADQMHMLGGRGEGSSGITPQRQPAKVRNNDKAYAYAGDDFHDDDIPF
Nucleotide
Download Length: 447 bp
>NTDB_id=893960 R3J34_RS03035 WP_038210386.1 703650..704096(-) (ssb) [Xylella fastidiosa subsp. multiplex strain CFBP8070]
ATGGCACGCGGAATTAACAAGGTGATCCTAGTCGGCAACCTGGGGAACGAACCGGATATCAAATACACCCAAAGCGGCAT
GACGATCACCAGCATTAGCCTAGCGACCAGCAGCGGACGCAAGGACAGAGAGGGCAATACCCAGGAGCGGACCGAATGGC
ACCGCGTCAAGTTTTTCGGAAAGCTGGGCGAGATTGCCGCCGAATATCTGCATAAGGGATCGCAGTGCTACATAGAGGGC
ACCATCCGTTACGACAAGTTCACCGGCAATGATGGCCAGGACCGTTATGTCACTGAGATTATTGCTGACCAAATGCACAT
GCTCGGCGGTCGCGGTGAAGGCTCCAGCGGTATCACGCCACAGCGGCAACCGGCAAAGGTCCGTAACAACGATAAAGCCT
ATGCGTATGCAGGCGACGACTTCCACGATGACGACATCCCGTTTTAG
ATGGCACGCGGAATTAACAAGGTGATCCTAGTCGGCAACCTGGGGAACGAACCGGATATCAAATACACCCAAAGCGGCAT
GACGATCACCAGCATTAGCCTAGCGACCAGCAGCGGACGCAAGGACAGAGAGGGCAATACCCAGGAGCGGACCGAATGGC
ACCGCGTCAAGTTTTTCGGAAAGCTGGGCGAGATTGCCGCCGAATATCTGCATAAGGGATCGCAGTGCTACATAGAGGGC
ACCATCCGTTACGACAAGTTCACCGGCAATGATGGCCAGGACCGTTATGTCACTGAGATTATTGCTGACCAAATGCACAT
GCTCGGCGGTCGCGGTGAAGGCTCCAGCGGTATCACGCCACAGCGGCAACCGGCAAAGGTCCGTAACAACGATAAAGCCT
ATGCGTATGCAGGCGACGACTTCCACGATGACGACATCCCGTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
41.477 |
100 |
0.493 |
| ssb | Neisseria meningitidis MC58 |
38.15 |
100 |
0.446 |
| ssb | Neisseria gonorrhoeae MS11 |
38.15 |
100 |
0.446 |
| ssb | Glaesserella parasuis strain SC1401 |
41.304 |
93.243 |
0.385 |