Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | R3H60_RS07160 | Genome accession | NZ_CP136950 |
| Coordinates | 1408744..1408923 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain Spyo06 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1408744..1449360 | 1408744..1408923 | within | 0 |
Gene organization within MGE regions
Location: 1408744..1449360
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R3H60_RS07160 (R3H60_07150) | prx | 1408744..1408923 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| R3H60_RS07165 (R3H60_07155) | sda1 | 1409162..1410334 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| R3H60_RS07170 (R3H60_07160) | - | 1410450..1411646 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| R3H60_RS07175 (R3H60_07165) | - | 1411757..1411942 (-) | 186 | WP_002988802.1 | holin | - |
| R3H60_RS07180 (R3H60_07170) | - | 1411939..1412238 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| R3H60_RS07185 (R3H60_07175) | - | 1412249..1412869 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| R3H60_RS07190 (R3H60_07180) | - | 1412872..1413033 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| R3H60_RS07195 (R3H60_07185) | - | 1413042..1414949 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| R3H60_RS07200 (R3H60_07190) | - | 1414960..1415595 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| R3H60_RS07205 (R3H60_07195) | - | 1415595..1416650 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| R3H60_RS07210 (R3H60_07200) | - | 1416647..1418629 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| R3H60_RS07215 (R3H60_07205) | - | 1418639..1419481 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| R3H60_RS07220 (R3H60_07210) | - | 1419493..1423875 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| R3H60_RS07225 (R3H60_07215) | - | 1423890..1424123 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| R3H60_RS07230 (R3H60_07220) | - | 1424198..1424653 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| R3H60_RS07235 (R3H60_07225) | - | 1424707..1425306 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| R3H60_RS07240 (R3H60_07230) | - | 1425318..1425677 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| R3H60_RS07245 (R3H60_07235) | - | 1425681..1426025 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| R3H60_RS07250 (R3H60_07240) | - | 1426022..1426300 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| R3H60_RS07255 (R3H60_07245) | - | 1426311..1426667 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| R3H60_RS07260 (R3H60_07250) | - | 1426679..1427566 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| R3H60_RS07265 (R3H60_07255) | - | 1427579..1428148 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| R3H60_RS07270 (R3H60_07260) | - | 1428304..1428570 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| R3H60_RS07275 (R3H60_07265) | - | 1428573..1428761 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| R3H60_RS07280 (R3H60_07270) | - | 1428792..1430237 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| R3H60_RS07285 (R3H60_07275) | - | 1430197..1431729 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| R3H60_RS07290 (R3H60_07280) | - | 1431745..1433022 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| R3H60_RS07295 (R3H60_07285) | - | 1433012..1433464 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| R3H60_RS07300 (R3H60_07290) | - | 1433554..1433970 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| R3H60_RS07305 (R3H60_07295) | - | 1433967..1434158 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| R3H60_RS07310 (R3H60_07300) | - | 1434148..1434999 (-) | 852 | WP_002988740.1 | DNA-methyltransferase | - |
| R3H60_RS07315 (R3H60_07305) | - | 1435008..1435274 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| R3H60_RS07320 (R3H60_07310) | - | 1435271..1435438 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| R3H60_RS07325 (R3H60_07315) | - | 1435439..1436761 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| R3H60_RS07330 (R3H60_07320) | - | 1436758..1437033 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| R3H60_RS07335 (R3H60_07325) | - | 1437420..1439804 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| R3H60_RS07340 (R3H60_07330) | - | 1439809..1441731 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| R3H60_RS07345 (R3H60_07335) | - | 1441774..1442331 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| R3H60_RS07350 (R3H60_07340) | - | 1442342..1442740 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| R3H60_RS07355 (R3H60_07345) | - | 1442744..1443898 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| R3H60_RS07360 (R3H60_07350) | - | 1443898..1444197 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| R3H60_RS07365 (R3H60_07355) | - | 1444285..1444488 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| R3H60_RS07370 (R3H60_07360) | - | 1444634..1445020 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| R3H60_RS07375 (R3H60_07365) | - | 1445017..1445220 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| R3H60_RS07380 (R3H60_07370) | - | 1445213..1445383 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| R3H60_RS07385 (R3H60_07375) | - | 1445380..1445655 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| R3H60_RS07390 (R3H60_07380) | - | 1445717..1445932 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| R3H60_RS07395 (R3H60_07385) | - | 1445980..1446393 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| R3H60_RS07400 (R3H60_07390) | - | 1446374..1446529 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| R3H60_RS07405 (R3H60_07395) | - | 1446855..1447205 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| R3H60_RS07410 (R3H60_07400) | - | 1447219..1447602 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| R3H60_RS07415 (R3H60_07405) | - | 1447613..1448164 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| R3H60_RS07420 (R3H60_07410) | - | 1448281..1449360 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=893668 R3H60_RS07160 WP_002988813.1 1408744..1408923(-) (prx) [Streptococcus pyogenes strain Spyo06]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=893668 R3H60_RS07160 WP_002988813.1 1408744..1408923(-) (prx) [Streptococcus pyogenes strain Spyo06]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |