Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | R3H60_RS05890 | Genome accession | NZ_CP136950 |
| Coordinates | 1169067..1169249 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain Spyo06 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1169067..1204077 | 1169067..1169249 | within | 0 |
Gene organization within MGE regions
Location: 1169067..1204077
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R3H60_RS05890 (R3H60_05880) | prx | 1169067..1169249 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| R3H60_RS05895 (R3H60_05885) | sda3 | 1169488..1170288 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| R3H60_RS05900 (R3H60_05890) | - | 1170559..1170993 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| R3H60_RS05905 (R3H60_05895) | - | 1171063..1172268 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| R3H60_RS05910 (R3H60_05900) | - | 1172384..1172611 (-) | 228 | WP_003058873.1 | phage holin | - |
| R3H60_RS05915 (R3H60_05905) | - | 1172608..1172883 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| R3H60_RS05920 (R3H60_05910) | - | 1172893..1173510 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| R3H60_RS05925 (R3H60_05915) | - | 1173507..1173944 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| R3H60_RS05930 (R3H60_05920) | - | 1173956..1175824 (-) | 1869 | WP_011285615.1 | gp58-like family protein | - |
| R3H60_RS05935 (R3H60_05925) | - | 1175821..1176516 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| R3H60_RS05940 (R3H60_05930) | - | 1176513..1178870 (-) | 2358 | WP_010922453.1 | hypothetical protein | - |
| R3H60_RS05945 (R3H60_05935) | - | 1178870..1179241 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| R3H60_RS05950 (R3H60_05940) | - | 1179256..1179519 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| R3H60_RS05955 (R3H60_05945) | - | 1179530..1180123 (-) | 594 | WP_010922456.1 | tail protein | - |
| R3H60_RS05960 (R3H60_05950) | - | 1180135..1180470 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| R3H60_RS05965 (R3H60_05955) | - | 1180471..1180707 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| R3H60_RS05970 (R3H60_05960) | - | 1180700..1181038 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| R3H60_RS05975 (R3H60_05965) | - | 1180998..1181420 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| R3H60_RS05980 (R3H60_05970) | - | 1181430..1181630 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| R3H60_RS05985 (R3H60_05975) | - | 1181630..1182541 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| R3H60_RS05990 (R3H60_05980) | - | 1182566..1183027 (-) | 462 | WP_011285618.1 | DUF4355 domain-containing protein | - |
| R3H60_RS05995 (R3H60_05985) | - | 1183108..1184523 (-) | 1416 | WP_011285619.1 | terminase | - |
| R3H60_RS06000 (R3H60_05990) | - | 1184633..1184899 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| R3H60_RS06005 (R3H60_05995) | - | 1184892..1185071 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| R3H60_RS06010 (R3H60_06000) | - | 1185121..1185345 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| R3H60_RS06015 (R3H60_06005) | - | 1185351..1186844 (-) | 1494 | WP_015446231.1 | hypothetical protein | - |
| R3H60_RS06020 (R3H60_06010) | - | 1186837..1188105 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| R3H60_RS06025 (R3H60_06015) | - | 1188102..1188458 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| R3H60_RS06030 (R3H60_06020) | - | 1188607..1188951 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| R3H60_RS06035 (R3H60_06025) | - | 1189060..1189479 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| R3H60_RS06040 (R3H60_06030) | - | 1189746..1190381 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| R3H60_RS06045 (R3H60_06035) | - | 1190383..1190652 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| R3H60_RS06050 (R3H60_06040) | - | 1190736..1191248 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| R3H60_RS06055 (R3H60_06045) | - | 1191245..1191586 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| R3H60_RS06060 (R3H60_06050) | - | 1191764..1191931 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| R3H60_RS06065 (R3H60_06055) | - | 1191941..1192738 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| R3H60_RS06070 (R3H60_06060) | - | 1192735..1193664 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| R3H60_RS06075 (R3H60_06065) | - | 1193667..1193996 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| R3H60_RS06080 (R3H60_06070) | - | 1194052..1194258 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| R3H60_RS06085 (R3H60_06075) | - | 1194267..1194407 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| R3H60_RS06090 (R3H60_06080) | - | 1194404..1194637 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| R3H60_RS06095 (R3H60_06085) | - | 1194618..1195007 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| R3H60_RS06100 (R3H60_06090) | - | 1195152..1195391 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| R3H60_RS06105 (R3H60_06095) | - | 1195491..1195676 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| R3H60_RS06110 (R3H60_06100) | - | 1195678..1195990 (-) | 313 | Protein_1161 | excisionase | - |
| R3H60_RS06115 (R3H60_06105) | - | 1196068..1196253 (-) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| R3H60_RS06120 (R3H60_06110) | - | 1196420..1196659 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| R3H60_RS06125 (R3H60_06115) | - | 1196801..1197607 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| R3H60_RS06130 (R3H60_06120) | - | 1197542..1197808 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| R3H60_RS06135 (R3H60_06125) | - | 1197840..1198556 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| R3H60_RS06140 (R3H60_06130) | - | 1198568..1198759 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| R3H60_RS06145 (R3H60_06135) | - | 1199395..1199490 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| R3H60_RS06150 (R3H60_06140) | - | 1199913..1200260 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| R3H60_RS06155 (R3H60_06145) | - | 1200264..1200644 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| R3H60_RS06160 (R3H60_06150) | - | 1200656..1200922 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| R3H60_RS06165 (R3H60_06155) | - | 1201046..1202188 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| R3H60_RS06170 (R3H60_06160) | - | 1202278..1202553 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| R3H60_RS06175 (R3H60_06165) | - | 1202652..1203239 (-) | 588 | WP_010922482.1 | YpmS family protein | - |
| R3H60_RS06180 (R3H60_06170) | - | 1203217..1204059 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=893661 R3H60_RS05890 WP_011017964.1 1169067..1169249(-) (prx) [Streptococcus pyogenes strain Spyo06]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=893661 R3H60_RS05890 WP_011017964.1 1169067..1169249(-) (prx) [Streptococcus pyogenes strain Spyo06]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |