Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | R3H60_RS05045 | Genome accession | NZ_CP136950 |
| Coordinates | 1007326..1007514 (-) | Length | 62 a.a. |
| NCBI ID | WP_011285559.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain Spyo06 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 999742..1046052 | 1007326..1007514 | within | 0 |
Gene organization within MGE regions
Location: 999742..1046052
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R3H60_RS05010 (R3H60_05000) | pfkA | 999742..1000755 (-) | 1014 | WP_010922375.1 | 6-phosphofructokinase | - |
| R3H60_RS05015 (R3H60_05005) | - | 1000835..1003945 (-) | 3111 | WP_010922376.1 | DNA polymerase III subunit alpha | - |
| R3H60_RS05020 (R3H60_05010) | - | 1004130..1004501 (+) | 372 | WP_010922377.1 | GntR family transcriptional regulator | - |
| R3H60_RS05025 (R3H60_05015) | - | 1004501..1005199 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| R3H60_RS05030 (R3H60_05020) | - | 1005209..1005994 (+) | 786 | WP_010922378.1 | hypothetical protein | - |
| R3H60_RS05035 (R3H60_05025) | - | 1006121..1006735 (-) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| R3H60_RS05045 (R3H60_05035) | prx | 1007326..1007514 (-) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| R3H60_RS05050 (R3H60_05040) | speA | 1007734..1008489 (+) | 756 | WP_011285560.1 | streptococcal pyrogenic exotoxin SpeA | - |
| R3H60_RS05055 (R3H60_05045) | - | 1008611..1009270 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| R3H60_RS05060 (R3H60_05050) | - | 1009270..1009491 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| R3H60_RS05065 (R3H60_05055) | - | 1009501..1010274 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| R3H60_RS05070 (R3H60_05060) | - | 1010285..1010887 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| R3H60_RS05075 (R3H60_05065) | - | 1010899..1011663 (-) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| R3H60_RS05080 (R3H60_05070) | - | 1011665..1011997 (-) | 333 | WP_011285562.1 | phage holin | - |
| R3H60_RS05085 (R3H60_05075) | - | 1011997..1012320 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| R3H60_RS05090 (R3H60_05080) | - | 1012334..1012456 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| R3H60_RS05095 (R3H60_05085) | - | 1012470..1012817 (-) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| R3H60_RS05100 (R3H60_05090) | - | 1012828..1014690 (-) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| R3H60_RS05105 (R3H60_05095) | - | 1014695..1018135 (-) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| R3H60_RS05110 (R3H60_05100) | - | 1018136..1019620 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| R3H60_RS05115 (R3H60_05105) | - | 1019621..1021426 (-) | 1806 | WP_011054802.1 | tail protein | - |
| R3H60_RS05120 (R3H60_05110) | - | 1021419..1021877 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| R3H60_RS05125 (R3H60_05115) | - | 1021850..1022167 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| R3H60_RS05130 (R3H60_05120) | - | 1022180..1022686 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| R3H60_RS05135 (R3H60_05125) | - | 1022698..1023108 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| R3H60_RS05140 (R3H60_05130) | - | 1023110..1023505 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| R3H60_RS05145 (R3H60_05135) | - | 1023502..1023813 (-) | 312 | WP_011285567.1 | hypothetical protein | - |
| R3H60_RS05150 (R3H60_05140) | - | 1023810..1024154 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| R3H60_RS05155 (R3H60_05145) | - | 1024168..1024461 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| R3H60_RS05160 (R3H60_05150) | - | 1024474..1025364 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| R3H60_RS05165 (R3H60_05155) | - | 1025383..1025952 (-) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| R3H60_RS05170 (R3H60_05160) | - | 1026061..1026195 (-) | 135 | WP_015055956.1 | hypothetical protein | - |
| R3H60_RS05175 (R3H60_05165) | - | 1026197..1026466 (-) | 270 | WP_011285568.1 | hypothetical protein | - |
| R3H60_RS05180 (R3H60_05170) | - | 1026473..1027381 (-) | 909 | WP_011285569.1 | minor capsid protein | - |
| R3H60_RS05185 (R3H60_05175) | - | 1027350..1028675 (-) | 1326 | WP_011285570.1 | phage portal protein | - |
| R3H60_RS05190 (R3H60_05180) | - | 1028675..1029949 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| R3H60_RS05195 (R3H60_05185) | - | 1029939..1030319 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| R3H60_RS05200 (R3H60_05190) | - | 1030929..1031363 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| R3H60_RS05205 (R3H60_05195) | - | 1031649..1031915 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| R3H60_RS05210 (R3H60_05200) | - | 1031912..1032436 (-) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| R3H60_RS05215 (R3H60_05205) | - | 1032439..1033071 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| R3H60_RS05220 (R3H60_05210) | - | 1033073..1033357 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| R3H60_RS05225 (R3H60_05215) | - | 1033354..1033524 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| R3H60_RS05230 (R3H60_05220) | - | 1033521..1033757 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| R3H60_RS05235 (R3H60_05225) | - | 1033757..1034002 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| R3H60_RS05240 (R3H60_05230) | - | 1033999..1034355 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| R3H60_RS05245 (R3H60_05235) | - | 1034352..1034792 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| R3H60_RS05250 (R3H60_05240) | - | 1034792..1034995 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| R3H60_RS05255 (R3H60_05245) | ssb | 1035001..1035426 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| R3H60_RS05260 (R3H60_05250) | - | 1035419..1036093 (-) | 675 | WP_011285576.1 | ERF family protein | - |
| R3H60_RS05265 (R3H60_05255) | - | 1036094..1036576 (-) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| R3H60_RS05270 (R3H60_05260) | - | 1036598..1036852 (-) | 255 | WP_011285578.1 | hypothetical protein | - |
| R3H60_RS05275 (R3H60_05265) | - | 1036833..1037186 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| R3H60_RS05280 (R3H60_05270) | - | 1037327..1038109 (-) | 783 | WP_011285581.1 | ATP-binding protein | - |
| R3H60_RS05285 (R3H60_05275) | - | 1038096..1038926 (-) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| R3H60_RS05290 (R3H60_05280) | - | 1038940..1039128 (-) | 189 | Protein_997 | XRE family transcriptional regulator | - |
| R3H60_RS05295 (R3H60_05285) | - | 1039362..1039601 (+) | 240 | WP_227874181.1 | hypothetical protein | - |
| R3H60_RS05300 (R3H60_05290) | - | 1039732..1039941 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| R3H60_RS05305 (R3H60_05295) | - | 1040051..1040251 (-) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| R3H60_RS05310 (R3H60_05300) | - | 1040325..1040711 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| R3H60_RS05315 (R3H60_05305) | - | 1040700..1040909 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| R3H60_RS05320 (R3H60_05310) | - | 1040963..1041562 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| R3H60_RS05325 (R3H60_05315) | - | 1041592..1041750 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| R3H60_RS05330 (R3H60_05320) | - | 1042107..1042931 (+) | 825 | WP_011285584.1 | XRE family transcriptional regulator | - |
| R3H60_RS05335 (R3H60_05325) | - | 1042967..1043860 (+) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| R3H60_RS05340 (R3H60_05330) | - | 1043981..1045069 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| R3H60_RS05345 (R3H60_05335) | - | 1045432..1046052 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7290.41 Da Isoelectric Point: 4.3313
>NTDB_id=893657 R3H60_RS05045 WP_011285559.1 1007326..1007514(-) (prx) [Streptococcus pyogenes strain Spyo06]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=893657 R3H60_RS05045 WP_011285559.1 1007326..1007514(-) (prx) [Streptococcus pyogenes strain Spyo06]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
95.161 |
0.952 |
| prx | Streptococcus pyogenes MGAS315 |
79.032 |
100 |
0.79 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
95.161 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
95.161 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
66.129 |
0.548 |