Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | R3H37_RS03505 | Genome accession | NZ_CP136948 |
| Coordinates | 676959..677141 (+) | Length | 60 a.a. |
| NCBI ID | WP_032463717.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain Spyo01 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 633071..677141 | 676959..677141 | within | 0 |
Gene organization within MGE regions
Location: 633071..677141
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R3H37_RS03185 (R3H37_03185) | - | 633089..633931 (+) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
| R3H37_RS03190 (R3H37_03190) | - | 633909..634496 (+) | 588 | WP_002989129.1 | YpmS family protein | - |
| R3H37_RS03195 (R3H37_03195) | - | 634595..634870 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| R3H37_RS03200 (R3H37_03200) | - | 634960..636102 (-) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| R3H37_RS03205 (R3H37_03205) | - | 636239..636919 (-) | 681 | WP_030127420.1 | hypothetical protein | - |
| R3H37_RS03210 (R3H37_03210) | - | 636954..637712 (-) | 759 | WP_030127421.1 | XRE family transcriptional regulator | - |
| R3H37_RS03215 (R3H37_03215) | - | 638100..638249 (+) | 150 | WP_014635531.1 | hypothetical protein | - |
| R3H37_RS03220 (R3H37_03220) | - | 638235..638450 (-) | 216 | WP_014635530.1 | hypothetical protein | - |
| R3H37_RS03225 (R3H37_03225) | - | 638509..638667 (+) | 159 | WP_330554717.1 | hypothetical protein | - |
| R3H37_RS03230 (R3H37_03230) | - | 638699..639298 (-) | 600 | WP_030127422.1 | hypothetical protein | - |
| R3H37_RS03235 (R3H37_03235) | - | 639353..639499 (+) | 147 | WP_021340823.1 | hypothetical protein | - |
| R3H37_RS03240 (R3H37_03240) | - | 639496..639978 (-) | 483 | WP_021340824.1 | hypothetical protein | - |
| R3H37_RS03245 (R3H37_03245) | - | 640052..640258 (+) | 207 | WP_001157159.1 | helix-turn-helix domain-containing protein | - |
| R3H37_RS03250 (R3H37_03250) | - | 640504..640713 (-) | 210 | WP_002984292.1 | hypothetical protein | - |
| R3H37_RS03255 (R3H37_03255) | - | 640863..641102 (-) | 240 | WP_011284879.1 | hypothetical protein | - |
| R3H37_RS03260 (R3H37_03260) | - | 641269..641454 (+) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| R3H37_RS03265 (R3H37_03265) | - | 641532..641843 (+) | 312 | WP_014411880.1 | hypothetical protein | - |
| R3H37_RS03270 (R3H37_03270) | - | 641845..642015 (+) | 171 | WP_023611037.1 | hypothetical protein | - |
| R3H37_RS03275 (R3H37_03275) | - | 642008..642211 (+) | 204 | WP_030127424.1 | hypothetical protein | - |
| R3H37_RS03280 (R3H37_03280) | - | 642208..642594 (+) | 387 | WP_030127425.1 | hypothetical protein | - |
| R3H37_RS03285 (R3H37_03285) | - | 642591..642743 (+) | 153 | WP_017647437.1 | hypothetical protein | - |
| R3H37_RS03290 (R3H37_03290) | - | 642740..642943 (+) | 204 | WP_030127426.1 | hypothetical protein | - |
| R3H37_RS03295 (R3H37_03295) | - | 643031..643330 (+) | 300 | WP_030127427.1 | hypothetical protein | - |
| R3H37_RS03300 (R3H37_03300) | - | 643330..644487 (+) | 1158 | WP_011888943.1 | DUF2800 domain-containing protein | - |
| R3H37_RS03305 (R3H37_03305) | - | 644496..645059 (+) | 564 | WP_086934854.1 | DUF2815 family protein | - |
| R3H37_RS03310 (R3H37_03310) | - | 645102..647024 (+) | 1923 | WP_030127429.1 | DNA polymerase | - |
| R3H37_RS03315 (R3H37_03315) | - | 647029..649413 (+) | 2385 | WP_032463709.1 | phage/plasmid primase, P4 family | - |
| R3H37_RS03320 (R3H37_03320) | - | 649799..650074 (+) | 276 | WP_011054885.1 | VRR-NUC domain-containing protein | - |
| R3H37_RS03325 (R3H37_03325) | - | 650071..651393 (+) | 1323 | WP_030127431.1 | SNF2-related protein | - |
| R3H37_RS03330 (R3H37_03330) | - | 651394..651564 (+) | 171 | WP_164972002.1 | hypothetical protein | - |
| R3H37_RS03335 (R3H37_03335) | - | 651557..651829 (+) | 273 | WP_011054882.1 | hypothetical protein | - |
| R3H37_RS03340 (R3H37_03340) | - | 651832..651978 (+) | 147 | WP_023079210.1 | hypothetical protein | - |
| R3H37_RS03345 (R3H37_03345) | - | 651962..652378 (+) | 417 | WP_011054881.1 | transcriptional regulator | - |
| R3H37_RS03350 (R3H37_03350) | - | 652468..652920 (+) | 453 | WP_030127432.1 | terminase small subunit | - |
| R3H37_RS03355 (R3H37_03355) | - | 652898..654205 (+) | 1308 | WP_014635515.1 | PBSX family phage terminase large subunit | - |
| R3H37_RS03360 (R3H37_03360) | - | 654217..655707 (+) | 1491 | WP_032461297.1 | phage portal protein | - |
| R3H37_RS03365 (R3H37_03365) | - | 655688..656602 (+) | 915 | WP_032463710.1 | minor capsid protein | - |
| R3H37_RS03370 (R3H37_03370) | - | 656618..656884 (+) | 267 | WP_030127435.1 | hypothetical protein | - |
| R3H37_RS03375 (R3H37_03375) | - | 657028..657561 (+) | 534 | WP_030127436.1 | DUF4355 domain-containing protein | - |
| R3H37_RS03380 (R3H37_03380) | - | 657571..657951 (+) | 381 | WP_002990036.1 | structural protein | - |
| R3H37_RS03385 (R3H37_03385) | - | 657954..659003 (+) | 1050 | WP_030127437.1 | major capsid protein | - |
| R3H37_RS03390 (R3H37_03390) | - | 659015..659281 (+) | 267 | WP_030127438.1 | HeH/LEM domain-containing protein | - |
| R3H37_RS03395 (R3H37_03395) | - | 659293..659646 (+) | 354 | WP_030127439.1 | phage head-tail connector protein | - |
| R3H37_RS03400 (R3H37_03400) | - | 659643..659939 (+) | 297 | WP_032463711.1 | hypothetical protein | - |
| R3H37_RS03405 (R3H37_03405) | - | 659939..660295 (+) | 357 | WP_030127441.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| R3H37_RS03410 (R3H37_03410) | - | 660292..660690 (+) | 399 | WP_030127442.1 | DUF3168 domain-containing protein | - |
| R3H37_RS03415 (R3H37_03415) | - | 660678..661196 (+) | 519 | WP_030127443.1 | phage major tail protein, TP901-1 family | - |
| R3H37_RS03420 (R3H37_03420) | - | 661250..661618 (+) | 369 | WP_030127444.1 | tail assembly chaperone | - |
| R3H37_RS03425 (R3H37_03425) | - | 661639..661956 (+) | 318 | WP_030127445.1 | hypothetical protein | - |
| R3H37_RS03430 (R3H37_03430) | - | 661956..664703 (+) | 2748 | WP_050436576.1 | phage tail tape measure protein | - |
| R3H37_RS03435 (R3H37_03435) | - | 664703..665473 (+) | 771 | WP_030127447.1 | distal tail protein Dit | - |
| R3H37_RS03440 (R3H37_03440) | - | 665470..667581 (+) | 2112 | WP_136022775.1 | phage tail spike protein | - |
| R3H37_RS03445 (R3H37_03445) | - | 667578..668792 (+) | 1215 | WP_011284843.1 | hypothetical protein | - |
| R3H37_RS03450 (R3H37_03450) | - | 668794..669108 (+) | 315 | WP_021340983.1 | hypothetical protein | - |
| R3H37_RS03455 (R3H37_03455) | - | 669119..670941 (+) | 1823 | Protein_618 | gp58-like family protein | - |
| R3H37_RS03460 (R3H37_03460) | - | 670953..671384 (+) | 432 | WP_020837375.1 | DUF1617 family protein | - |
| R3H37_RS03465 (R3H37_03465) | - | 671387..671992 (+) | 606 | WP_094751271.1 | DUF1366 domain-containing protein | - |
| R3H37_RS03470 (R3H37_03470) | - | 672008..672463 (+) | 456 | WP_002988455.1 | phage holin family protein | - |
| R3H37_RS03475 (R3H37_03475) | - | 672465..672587 (+) | 123 | WP_027968869.1 | hypothetical protein | - |
| R3H37_RS03480 (R3H37_03480) | - | 672575..673771 (+) | 1197 | WP_330554718.1 | glucosaminidase domain-containing protein | - |
| R3H37_RS03485 (R3H37_03485) | - | 673920..674084 (+) | 165 | WP_021340366.1 | hypothetical protein | - |
| R3H37_RS03490 (R3H37_03490) | - | 674117..674677 (+) | 561 | WP_011018106.1 | GNAT family N-acetyltransferase | - |
| R3H37_RS03495 (R3H37_03495) | spem | 675061..675774 (+) | 714 | WP_032463716.1 | streptococcal pyrogenic exotoxin SpeM | - |
| R3H37_RS03500 (R3H37_03500) | spel | 676056..676844 (+) | 789 | WP_021340779.1 | streptococcal pyrogenic exotoxin SpeL | - |
| R3H37_RS03505 (R3H37_03505) | prx | 676959..677141 (+) | 183 | WP_032463717.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6949.84 Da Isoelectric Point: 4.0606
>NTDB_id=893604 R3H37_RS03505 WP_032463717.1 676959..677141(+) (prx) [Streptococcus pyogenes strain Spyo01]
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELSR
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=893604 R3H37_RS03505 WP_032463717.1 676959..677141(+) (prx) [Streptococcus pyogenes strain Spyo01]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
96.667 |
0.967 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
81.667 |
100 |
0.817 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |