Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | RWA18_RS03040 | Genome accession | NZ_CP136121 |
| Coordinates | 599219..599656 (+) | Length | 145 a.a. |
| NCBI ID | WP_316079515.1 | Uniprot ID | - |
| Organism | Lacticaseibacillus paracasei strain LMG 19719 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 592004..634381 | 599219..599656 | within | 0 |
Gene organization within MGE regions
Location: 592004..634381
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RWA18_RS02975 (RWA18_02980) | - | 592004..593131 (-) | 1128 | WP_316079509.1 | tyrosine-type recombinase/integrase | - |
| RWA18_RS02980 (RWA18_02985) | - | 593338..594036 (-) | 699 | WP_316079510.1 | hypothetical protein | - |
| RWA18_RS02985 (RWA18_02990) | - | 594104..594886 (-) | 783 | WP_316079511.1 | S24 family peptidase | - |
| RWA18_RS02990 (RWA18_02995) | - | 595047..595301 (+) | 255 | WP_005688508.1 | helix-turn-helix domain-containing protein | - |
| RWA18_RS02995 (RWA18_03000) | - | 595304..596062 (+) | 759 | WP_016373253.1 | phage repressor protein/antirepressor Ant | - |
| RWA18_RS03000 (RWA18_03005) | - | 596063..596197 (+) | 135 | WP_316079512.1 | hypothetical protein | - |
| RWA18_RS03005 (RWA18_03010) | - | 596180..596392 (-) | 213 | WP_096772518.1 | hypothetical protein | - |
| RWA18_RS03010 (RWA18_03015) | - | 596458..596814 (+) | 357 | WP_019897215.1 | DUF771 domain-containing protein | - |
| RWA18_RS03015 (RWA18_03020) | - | 596899..597051 (+) | 153 | WP_016388314.1 | hypothetical protein | - |
| RWA18_RS03020 (RWA18_03025) | - | 597056..597258 (+) | 203 | Protein_565 | hypothetical protein | - |
| RWA18_RS03025 (RWA18_03030) | - | 597276..597767 (+) | 492 | WP_316079513.1 | siphovirus Gp157 family protein | - |
| RWA18_RS03030 (RWA18_03035) | - | 597778..598533 (+) | 756 | WP_316079514.1 | ERF family protein | - |
| RWA18_RS03035 (RWA18_03040) | - | 598536..599204 (+) | 669 | WP_316079626.1 | putative HNHc nuclease | - |
| RWA18_RS03040 (RWA18_03045) | ssb | 599219..599656 (+) | 438 | WP_316079515.1 | single-stranded DNA-binding protein | Machinery gene |
| RWA18_RS03045 (RWA18_03050) | - | 599673..600506 (+) | 834 | WP_316079516.1 | helix-turn-helix domain-containing protein | - |
| RWA18_RS03050 (RWA18_03055) | - | 600503..601765 (+) | 1263 | WP_316079517.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| RWA18_RS03055 (RWA18_03060) | - | 601767..602111 (+) | 345 | WP_316079518.1 | hypothetical protein | - |
| RWA18_RS03060 (RWA18_03065) | - | 602153..602554 (+) | 402 | WP_128518502.1 | RusA family crossover junction endodeoxyribonuclease | - |
| RWA18_RS03065 (RWA18_03070) | - | 602567..603031 (+) | 465 | WP_316079519.1 | endonuclease | - |
| RWA18_RS03070 (RWA18_03075) | - | 603043..603753 (+) | 711 | WP_316079520.1 | N-6 DNA methylase | - |
| RWA18_RS03075 (RWA18_03080) | - | 603740..604126 (+) | 387 | WP_316079521.1 | hypothetical protein | - |
| RWA18_RS03080 (RWA18_03085) | - | 604123..604248 (+) | 126 | WP_316079522.1 | hypothetical protein | - |
| RWA18_RS03085 (RWA18_03090) | - | 604245..604796 (+) | 552 | WP_316079523.1 | DUF1642 domain-containing protein | - |
| RWA18_RS03090 (RWA18_03095) | - | 604783..605001 (+) | 219 | WP_316079524.1 | hypothetical protein | - |
| RWA18_RS03095 (RWA18_03100) | - | 604991..605407 (+) | 417 | WP_316079525.1 | hypothetical protein | - |
| RWA18_RS03100 (RWA18_03105) | - | 605404..605691 (+) | 288 | WP_316079526.1 | hypothetical protein | - |
| RWA18_RS03105 (RWA18_03110) | - | 606162..606596 (+) | 435 | WP_316079527.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| RWA18_RS03110 (RWA18_03115) | - | 607031..608038 (+) | 1008 | WP_160528737.1 | hypothetical protein | - |
| RWA18_RS03115 (RWA18_03120) | - | 608043..608522 (+) | 480 | WP_160528738.1 | hypothetical protein | - |
| RWA18_RS03120 (RWA18_03125) | - | 608804..610021 (+) | 1218 | WP_316079528.1 | GcrA family cell cycle regulator | - |
| RWA18_RS03125 (RWA18_03130) | - | 610008..610538 (+) | 531 | WP_316079529.1 | NUMOD4 domain-containing protein | - |
| RWA18_RS03130 (RWA18_03135) | - | 610542..610862 (+) | 321 | WP_316079530.1 | ribonucleoside-diphosphate reductase | - |
| RWA18_RS03135 (RWA18_03140) | - | 610865..611188 (+) | 324 | WP_316079531.1 | hypothetical protein | - |
| RWA18_RS03140 (RWA18_03145) | - | 611201..611758 (+) | 558 | WP_316079532.1 | hypothetical protein | - |
| RWA18_RS03145 (RWA18_03150) | - | 611792..611947 (+) | 156 | WP_183406853.1 | hypothetical protein | - |
| RWA18_RS03150 (RWA18_03155) | - | 611990..612784 (+) | 795 | WP_316079533.1 | HNH endonuclease | - |
| RWA18_RS03155 (RWA18_03160) | - | 612985..613440 (+) | 456 | WP_003661401.1 | P27 family phage terminase small subunit | - |
| RWA18_RS03160 (RWA18_03165) | - | 613462..615174 (+) | 1713 | WP_316079534.1 | terminase TerL endonuclease subunit | - |
| RWA18_RS03165 (RWA18_03170) | - | 615186..615377 (+) | 192 | WP_003661399.1 | hypothetical protein | - |
| RWA18_RS03170 (RWA18_03175) | - | 615383..616636 (+) | 1254 | WP_316079535.1 | phage portal protein | - |
| RWA18_RS03175 (RWA18_03180) | - | 616590..617219 (+) | 630 | WP_003661395.1 | HK97 family phage prohead protease | - |
| RWA18_RS03180 (RWA18_03185) | - | 617261..618463 (+) | 1203 | WP_316079536.1 | phage major capsid protein | - |
| RWA18_RS03185 (RWA18_03190) | - | 618481..618720 (+) | 240 | WP_316079537.1 | Ig-like domain-containing protein | - |
| RWA18_RS03190 (RWA18_03195) | - | 618731..619090 (+) | 360 | WP_003564855.1 | head-tail connector protein | - |
| RWA18_RS03195 (RWA18_03200) | - | 619080..619409 (+) | 330 | WP_033573335.1 | head-tail adaptor protein | - |
| RWA18_RS03200 (RWA18_03205) | - | 619409..619795 (+) | 387 | WP_316079538.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| RWA18_RS03205 (RWA18_03210) | - | 619795..620181 (+) | 387 | WP_016363186.1 | hypothetical protein | - |
| RWA18_RS03210 (RWA18_03215) | - | 620215..620823 (+) | 609 | WP_316079539.1 | major tail protein | - |
| RWA18_RS03215 (RWA18_03220) | - | 620880..621065 (+) | 186 | WP_016373276.1 | Ig-like domain-containing protein | - |
| RWA18_RS03220 (RWA18_03225) | gpG | 621135..621548 (+) | 414 | WP_316079540.1 | phage tail assembly chaperone G | - |
| RWA18_RS03225 (RWA18_03230) | - | 621671..626443 (+) | 4773 | WP_316079541.1 | phage tail tape measure protein | - |
| RWA18_RS03230 (RWA18_03235) | - | 626444..628396 (+) | 1953 | WP_316079542.1 | distal tail protein Dit | - |
| RWA18_RS03235 (RWA18_03240) | - | 628397..631756 (+) | 3360 | WP_316079543.1 | phage tail protein | - |
| RWA18_RS03240 (RWA18_03245) | - | 631766..632056 (+) | 291 | WP_316079544.1 | hypothetical protein | - |
| RWA18_RS03245 (RWA18_03250) | - | 632049..632180 (+) | 132 | WP_260187340.1 | XkdX family protein | - |
| RWA18_RS03250 (RWA18_03255) | - | 632211..632609 (+) | 399 | WP_316079545.1 | hypothetical protein | - |
| RWA18_RS03255 (RWA18_03260) | - | 632578..632787 (+) | 210 | WP_016376687.1 | hypothetical protein | - |
| RWA18_RS03260 (RWA18_03265) | - | 632780..633226 (+) | 447 | WP_316079546.1 | phage holin | - |
| RWA18_RS03265 (RWA18_03270) | - | 633236..634381 (+) | 1146 | WP_316079547.1 | GH25 family lysozyme | - |
Sequence
Protein
Download Length: 145 a.a. Molecular weight: 15924.50 Da Isoelectric Point: 5.1662
>NTDB_id=888677 RWA18_RS03040 WP_316079515.1 599219..599656(+) (ssb) [Lacticaseibacillus paracasei strain LMG 19719]
MLNSVALTGRLTKDVDLRYTQSGTAVGSFTIAVDRQFRSANGERETDFINCAIWRKSAENFANFTHKGSLVGIEGHIQTR
TYDNAQGQKVFVTEVIVENFALLEPRQASQDGQQRSANNPAAASQGNSFANNGQPVDIRDDDLPF
MLNSVALTGRLTKDVDLRYTQSGTAVGSFTIAVDRQFRSANGERETDFINCAIWRKSAENFANFTHKGSLVGIEGHIQTR
TYDNAQGQKVFVTEVIVENFALLEPRQASQDGQQRSANNPAAASQGNSFANNGQPVDIRDDDLPF
Nucleotide
Download Length: 438 bp
>NTDB_id=888677 RWA18_RS03040 WP_316079515.1 599219..599656(+) (ssb) [Lacticaseibacillus paracasei strain LMG 19719]
ATGCTTAATTCAGTTGCTTTAACAGGCAGATTAACTAAAGACGTTGACCTTCGCTACACACAAAGCGGAACGGCAGTTGG
TTCATTTACGATTGCTGTTGATCGCCAATTTCGCAGCGCAAACGGCGAACGTGAAACTGACTTCATCAATTGTGCCATCT
GGCGTAAGTCTGCTGAGAACTTTGCCAACTTCACGCACAAGGGTTCACTTGTTGGCATCGAAGGCCATATCCAAACGCGT
ACGTATGATAACGCGCAAGGGCAGAAAGTATTCGTGACCGAGGTAATCGTTGAGAATTTTGCTTTGCTTGAGCCACGGCA
AGCGTCTCAGGATGGTCAACAACGATCGGCTAATAACCCAGCGGCCGCAAGCCAAGGCAACAGTTTTGCCAACAATGGTC
AGCCAGTCGATATCAGGGATGATGATCTTCCATTCTAA
ATGCTTAATTCAGTTGCTTTAACAGGCAGATTAACTAAAGACGTTGACCTTCGCTACACACAAAGCGGAACGGCAGTTGG
TTCATTTACGATTGCTGTTGATCGCCAATTTCGCAGCGCAAACGGCGAACGTGAAACTGACTTCATCAATTGTGCCATCT
GGCGTAAGTCTGCTGAGAACTTTGCCAACTTCACGCACAAGGGTTCACTTGTTGGCATCGAAGGCCATATCCAAACGCGT
ACGTATGATAACGCGCAAGGGCAGAAAGTATTCGTGACCGAGGTAATCGTTGAGAATTTTGCTTTGCTTGAGCCACGGCA
AGCGTCTCAGGATGGTCAACAACGATCGGCTAATAACCCAGCGGCCGCAAGCCAAGGCAACAGTTTTGCCAACAATGGTC
AGCCAGTCGATATCAGGGATGATGATCTTCCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
57.059 |
100 |
0.669 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
48.256 |
100 |
0.572 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
53.774 |
73.103 |
0.393 |
| ssb | Neisseria gonorrhoeae MS11 |
32.948 |
100 |
0.393 |
| ssb | Neisseria meningitidis MC58 |
32.37 |
100 |
0.386 |
| ssb | Vibrio cholerae strain A1552 |
31.214 |
100 |
0.372 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
37.241 |
100 |
0.372 |