Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | RWA13_RS04035 | Genome accession | NZ_CP136115 |
| Coordinates | 848117..848554 (+) | Length | 145 a.a. |
| NCBI ID | WP_049179754.1 | Uniprot ID | A0A853J726 |
| Organism | Lacticaseibacillus rhamnosus strain LMG 23277 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 838562..882028 | 848117..848554 | within | 0 |
Gene organization within MGE regions
Location: 838562..882028
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RWA13_RS03970 (RWA13_03970) | - | 838562..839689 (-) | 1128 | WP_049179772.1 | site-specific integrase | - |
| RWA13_RS03975 (RWA13_03975) | - | 839862..840527 (-) | 666 | WP_316054210.1 | transcriptional regulator | - |
| RWA13_RS03980 (RWA13_03980) | istA | 840631..841854 (+) | 1224 | WP_003555353.1 | IS21 family transposase | - |
| RWA13_RS03985 (RWA13_03985) | istB | 841864..842601 (+) | 738 | WP_003555349.1 | IS21-like element helper ATPase IstB | - |
| RWA13_RS03990 (RWA13_03990) | - | 842735..843511 (-) | 777 | WP_049179769.1 | XRE family transcriptional regulator | - |
| RWA13_RS03995 (RWA13_03995) | - | 843675..843902 (+) | 228 | WP_049179767.1 | hypothetical protein | - |
| RWA13_RS04000 (RWA13_04000) | - | 843927..844745 (+) | 819 | WP_049179765.1 | ORF6N domain-containing protein | - |
| RWA13_RS04005 (RWA13_04005) | - | 844742..844891 (+) | 150 | WP_180530720.1 | hypothetical protein | - |
| RWA13_RS04010 (RWA13_04010) | - | 844970..845326 (+) | 357 | WP_049179763.1 | DUF771 domain-containing protein | - |
| RWA13_RS04015 (RWA13_04015) | - | 845568..845771 (+) | 204 | WP_049179761.1 | hypothetical protein | - |
| RWA13_RS04020 (RWA13_04020) | - | 845789..846676 (+) | 888 | WP_049179759.1 | DUF1351 domain-containing protein | - |
| RWA13_RS04025 (RWA13_04025) | - | 846676..847431 (+) | 756 | WP_049179756.1 | ERF family protein | - |
| RWA13_RS04030 (RWA13_04030) | - | 847434..848102 (+) | 669 | WP_080980177.1 | putative HNHc nuclease | - |
| RWA13_RS04035 (RWA13_04035) | ssb | 848117..848554 (+) | 438 | WP_049179754.1 | single-stranded DNA-binding protein | Machinery gene |
| RWA13_RS04040 (RWA13_04040) | - | 848571..849404 (+) | 834 | WP_049179752.1 | helix-turn-helix domain-containing protein | - |
| RWA13_RS04045 (RWA13_04045) | - | 849401..850663 (+) | 1263 | WP_049179750.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| RWA13_RS04050 (RWA13_04050) | - | 850665..851009 (+) | 345 | WP_049179748.1 | hypothetical protein | - |
| RWA13_RS04055 (RWA13_04055) | - | 851022..851309 (+) | 288 | WP_049179746.1 | hypothetical protein | - |
| RWA13_RS04060 (RWA13_04060) | - | 851296..851550 (+) | 255 | WP_049179744.1 | hypothetical protein | - |
| RWA13_RS04065 (RWA13_04065) | - | 851547..851912 (+) | 366 | WP_016364507.1 | hypothetical protein | - |
| RWA13_RS04070 (RWA13_04070) | - | 851926..852777 (+) | 852 | WP_032964565.1 | DNA cytosine methyltransferase | - |
| RWA13_RS04075 (RWA13_04075) | - | 852770..853477 (+) | 708 | WP_049179741.1 | N-6 DNA methylase | - |
| RWA13_RS04080 (RWA13_04080) | - | 853474..853656 (+) | 183 | WP_048488361.1 | hypothetical protein | - |
| RWA13_RS04085 (RWA13_04085) | - | 853653..854183 (+) | 531 | WP_049179739.1 | DUF1642 domain-containing protein | - |
| RWA13_RS04090 (RWA13_04090) | - | 854173..854349 (+) | 177 | WP_175265236.1 | hypothetical protein | - |
| RWA13_RS04095 (RWA13_04095) | - | 854378..854656 (+) | 279 | WP_373418399.1 | hypothetical protein | - |
| RWA13_RS04100 (RWA13_04100) | - | 854653..854841 (+) | 189 | WP_005688546.1 | hypothetical protein | - |
| RWA13_RS04105 (RWA13_04105) | - | 854886..855125 (+) | 240 | WP_014569479.1 | hypothetical protein | - |
| RWA13_RS04110 (RWA13_04110) | - | 855175..855357 (+) | 183 | WP_048488379.1 | hypothetical protein | - |
| RWA13_RS04115 (RWA13_04115) | - | 855799..856242 (+) | 444 | WP_005714759.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| RWA13_RS04120 (RWA13_04120) | - | 856530..857390 (+) | 861 | WP_005686948.1 | hypothetical protein | - |
| RWA13_RS04125 (RWA13_04125) | - | 857931..859079 (+) | 1149 | WP_049179731.1 | GcrA family cell cycle regulator | - |
| RWA13_RS04130 (RWA13_04130) | - | 859072..859617 (+) | 546 | WP_049179729.1 | NUMOD4 domain-containing protein | - |
| RWA13_RS04135 (RWA13_04135) | - | 859614..859937 (+) | 324 | WP_049179727.1 | ribonucleoside-diphosphate reductase | - |
| RWA13_RS04140 (RWA13_04140) | - | 859941..860087 (+) | 147 | WP_155736806.1 | hypothetical protein | - |
| RWA13_RS04145 (RWA13_04145) | - | 860140..860934 (+) | 795 | WP_049179724.1 | HNH endonuclease | - |
| RWA13_RS04150 (RWA13_04150) | - | 861135..861590 (+) | 456 | WP_005686963.1 | P27 family phage terminase small subunit | - |
| RWA13_RS04155 (RWA13_04155) | - | 861612..863324 (+) | 1713 | WP_032953807.1 | terminase large subunit | - |
| RWA13_RS04160 (RWA13_04160) | - | 863336..863527 (+) | 192 | WP_003661399.1 | hypothetical protein | - |
| RWA13_RS04165 (RWA13_04165) | - | 863533..864786 (+) | 1254 | WP_049179722.1 | phage portal protein | - |
| RWA13_RS04170 (RWA13_04170) | - | 864740..865369 (+) | 630 | WP_049179720.1 | HK97 family phage prohead protease | - |
| RWA13_RS04175 (RWA13_04175) | - | 865411..866613 (+) | 1203 | WP_049179718.1 | phage major capsid protein | - |
| RWA13_RS04180 (RWA13_04180) | - | 866631..866870 (+) | 240 | WP_049179716.1 | Ig-like domain-containing protein | - |
| RWA13_RS04185 (RWA13_04185) | - | 866881..867240 (+) | 360 | WP_049179713.1 | head-tail connector protein | - |
| RWA13_RS04190 (RWA13_04190) | - | 867230..867559 (+) | 330 | WP_049179711.1 | head-tail adaptor protein | - |
| RWA13_RS04195 (RWA13_04195) | - | 867559..867945 (+) | 387 | WP_049179710.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| RWA13_RS04200 (RWA13_04200) | - | 867945..868331 (+) | 387 | WP_016389063.1 | hypothetical protein | - |
| RWA13_RS04205 (RWA13_04205) | - | 868365..868985 (+) | 621 | WP_049179707.1 | major tail protein | - |
| RWA13_RS04210 (RWA13_04210) | - | 869042..869227 (+) | 186 | WP_049179705.1 | Ig-like domain-containing protein | - |
| RWA13_RS04215 (RWA13_04215) | gpG | 869298..869711 (+) | 414 | WP_049179703.1 | phage tail assembly chaperone G | - |
| RWA13_RS04220 (RWA13_04220) | - | 869834..874696 (+) | 4863 | WP_049179700.1 | phage tail tape measure protein | - |
| RWA13_RS04225 (RWA13_04225) | - | 874697..876610 (+) | 1914 | WP_049179698.1 | distal tail protein Dit | - |
| RWA13_RS04230 (RWA13_04230) | - | 876611..879565 (+) | 2955 | WP_049179695.1 | phage tail protein | - |
| RWA13_RS04235 (RWA13_04235) | - | 879581..879910 (+) | 330 | WP_049179694.1 | hypothetical protein | - |
| RWA13_RS04240 (RWA13_04240) | - | 879907..880050 (+) | 144 | WP_005688592.1 | XkdX family protein | - |
| RWA13_RS04245 (RWA13_04245) | - | 880082..880381 (+) | 300 | WP_308706291.1 | hypothetical protein | - |
| RWA13_RS04250 (RWA13_04250) | - | 880396..880845 (+) | 450 | WP_049179692.1 | phage holin | - |
| RWA13_RS04255 (RWA13_04255) | - | 880856..882028 (+) | 1173 | WP_049179690.1 | GH25 family lysozyme | - |
Sequence
Protein
Download Length: 145 a.a. Molecular weight: 15906.53 Da Isoelectric Point: 5.7223
>NTDB_id=888521 RWA13_RS04035 WP_049179754.1 848117..848554(+) (ssb) [Lacticaseibacillus rhamnosus strain LMG 23277]
MLNSVALTGRLTKPVDLRYTQSGTAVGSFTIAVDRQFRSANGERETDFINCAIWRKSAENFANFTHKGSLVGIEGHIQTR
TYDNAQGQKVFVTEVIVENFALLEPRQASQDGQQRSANNPAAASQGNSFANNGQPVDIRDDDLPF
MLNSVALTGRLTKPVDLRYTQSGTAVGSFTIAVDRQFRSANGERETDFINCAIWRKSAENFANFTHKGSLVGIEGHIQTR
TYDNAQGQKVFVTEVIVENFALLEPRQASQDGQQRSANNPAAASQGNSFANNGQPVDIRDDDLPF
Nucleotide
Download Length: 438 bp
>NTDB_id=888521 RWA13_RS04035 WP_049179754.1 848117..848554(+) (ssb) [Lacticaseibacillus rhamnosus strain LMG 23277]
ATGCTTAATTCAGTTGCTTTAACAGGCAGATTAACTAAACCGGTTGACCTTCGCTACACACAAAGCGGAACGGCAGTTGG
TTCATTTACGATTGCTGTTGATCGCCAATTTCGCAGCGCAAACGGCGAACGTGAAACTGACTTCATCAATTGTGCCATCT
GGCGTAAGTCTGCTGAGAACTTTGCCAACTTCACGCACAAGGGTTCACTTGTTGGCATCGAAGGCCATATCCAAACGCGT
ACGTATGATAACGCGCAAGGGCAGAAAGTATTCGTGACCGAGGTAATCGTTGAGAATTTTGCTTTGCTTGAGCCACGGCA
AGCGTCTCAGGATGGTCAACAACGATCGGCTAATAACCCAGCGGCCGCAAGCCAAGGCAACAGTTTTGCCAACAATGGTC
AGCCAGTCGATATCAGGGATGATGATCTTCCATTCTAA
ATGCTTAATTCAGTTGCTTTAACAGGCAGATTAACTAAACCGGTTGACCTTCGCTACACACAAAGCGGAACGGCAGTTGG
TTCATTTACGATTGCTGTTGATCGCCAATTTCGCAGCGCAAACGGCGAACGTGAAACTGACTTCATCAATTGTGCCATCT
GGCGTAAGTCTGCTGAGAACTTTGCCAACTTCACGCACAAGGGTTCACTTGTTGGCATCGAAGGCCATATCCAAACGCGT
ACGTATGATAACGCGCAAGGGCAGAAAGTATTCGTGACCGAGGTAATCGTTGAGAATTTTGCTTTGCTTGAGCCACGGCA
AGCGTCTCAGGATGGTCAACAACGATCGGCTAATAACCCAGCGGCCGCAAGCCAAGGCAACAGTTTTGCCAACAATGGTC
AGCCAGTCGATATCAGGGATGATGATCTTCCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
56.471 |
100 |
0.662 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
47.674 |
100 |
0.566 |
| ssb | Neisseria gonorrhoeae MS11 |
32.37 |
100 |
0.386 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
52.83 |
73.103 |
0.386 |
| ssb | Neisseria meningitidis MC58 |
31.792 |
100 |
0.379 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
37.241 |
100 |
0.372 |
| ssb | Vibrio cholerae strain A1552 |
30.636 |
100 |
0.366 |