Detailed information NTG0887131

Bioinformatically predicted

Overview

• Name: clpP
• Type: Regulator
• Locus tag: RS401_RS25875
• Genome accession: NZ_CP135601
• Coordinates: 4948718..4949299 (+)
• Length: 193 a.a.
• NCBI ID: WP_001049162.1
• Uniprot ID: A0A9W5QPC2
• Organism: Bacillus sp. SI2
• Function: degradation of ComK; degradation of DegU (predicted from homology) Competence regulation

Genomic Context

Location: 4943718..4954299

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
RS401_RS25840 (RS401_25840)	-	4944712..4944918 (+)	207	WP_000216166.1	DUF1657 domain-containing protein	-
RS401_RS25845 (RS401_25845)	-	4945012..4945497 (+)	486	WP_001228539.1	YhcN/YlaJ family sporulation lipoprotein	-
RS401_RS25850 (RS401_25850)	spoVAC	4945528..4946004 (+)	477	WP_000095399.1	stage V sporulation protein AC	-
RS401_RS25855 (RS401_25855)	spoVAD	4946005..4947021 (+)	1017	WP_071736574.1	stage V sporulation protein AD	-
RS401_RS25860 (RS401_25860)	spoVAE	4947018..4947368 (+)	351	WP_000575919.1	stage V sporulation protein AE	-
RS401_RS25865 (RS401_25865)	-	4947380..4947586 (+)	207	WP_000215915.1	DUF1657 domain-containing protein	-
RS401_RS25870 (RS401_25870)	-	4947607..4948476 (+)	870	WP_000018934.1	DUF421 domain-containing protein	-
RS401_RS25875 (RS401_25875)	clpP	4948718..4949299 (+)	582	WP_001049162.1	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	Regulator
RS401_RS25880 (RS401_25880)	-	4949704..4949952 (-)	249	WP_000250307.1	HPr family phosphocarrier protein	-
RS401_RS25885 (RS401_25885)	whiA	4949976..4950926 (-)	951	WP_000006561.1	DNA-binding protein WhiA	-
RS401_RS25890 (RS401_25890)	yvcK	4951016..4951969 (-)	954	WP_000712178.1	YvcK family protein	-
RS401_RS25895 (RS401_25895)	rapZ	4951973..4952854 (-)	882	WP_000138464.1	RNase adapter RapZ	-
RS401_RS25900 (RS401_25900)	-	4952875..4953333 (-)	459	WP_001190080.1	8-oxo-dGTP diphosphatase	-

Sequence

Protein

• Length: 193 a.a.
• Molecular weight: 21419.67 Da
• Isoelectric Point: 5.0423

>NTDB_id=887131 RS401_RS25875 WP_001049162.1 4948718..4949299(+) (clpP) [Bacillus sp. SI2]
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLESQDPEKDIHIYINSPGGSITAGMAIYDT
MQFIKPQVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILFLREKLNQILADRTGQ
PLEVLQRDTDRDNFMTAEKALEYGLIDKIFTNR

Nucleotide

• Length: 582 bp

>NTDB_id=887131 RS401_RS25875 WP_001049162.1 4948718..4949299(+) (clpP) [Bacillus sp. SI2]
ATGAATTTAATTCCTACAGTAATTGAACAAACAAATCGTGGAGAACGCGCTTACGATATTTACTCTCGACTATTAAAAGA
CCGCATCATTATGCTTGGTAGTGCAATTGATGACAACGTAGCTAACTCAATCGTTTCCCAGCTTTTATTCTTGGAATCTC
AAGATCCTGAAAAAGATATTCATATCTACATCAACAGCCCTGGTGGTTCTATCACAGCAGGTATGGCAATTTACGATACA
ATGCAGTTTATTAAACCGCAAGTATCAACAATCTGTATCGGTATGGCTGCATCTATGGGTGCATTCTTACTTGCAGCAGG
TGAAAAAGGAAAACGTTATGCACTTCCAAACAGTGAAGTAATGATTCACCAACCACTTGGTGGTGCACAAGGTCAAGCGA
CTGAAATCGAAATCGCTGCAAAACGTATTCTATTCTTACGTGAAAAACTAAACCAAATTCTTGCTGACCGCACAGGTCAA
CCACTTGAAGTACTACAACGCGACACAGACCGCGACAACTTCATGACAGCAGAAAAAGCTTTAGAATACGGTTTAATCGA
TAAGATCTTTACAAATCGTTAA

Domains

Predicted by InterproScan.

• Clp protease (CLP_protease) (13-192)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
clpP	Bacillus subtilis subsp. subtilis str. 168	90.104	99.482	0.896
clpP	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	67.021	97.409	0.653
clpP	Streptococcus thermophilus LMG 18311	60.417	99.482	0.601
clpP	Streptococcus thermophilus LMD-9	60.417	99.482	0.601
clpP	Lactococcus lactis subsp. cremoris KW2	58.854	99.482	0.585
clpP	Streptococcus pneumoniae D39	57.292	99.482	0.57
clpP	Streptococcus pneumoniae Rx1	57.292	99.482	0.57
clpP	Streptococcus pneumoniae R6	57.292	99.482	0.57
clpP	Streptococcus pneumoniae TIGR4	57.292	99.482	0.57
clpP	Lactococcus lactis subsp. lactis strain DGCC12653	56.771	99.482	0.565
clpP	Streptococcus pyogenes JRS4	55.729	99.482	0.554
clpP	Streptococcus pyogenes MGAS315	55.729	99.482	0.554
clpP	Streptococcus mutans UA159	55.44	100	0.554