Detailed information
Bioinformatically predicted
Overview
| Name | clpP | Type | Regulator |
| Locus tag | RRU92_RS09735 | Genome accession | NZ_CP135436 |
| Coordinates | 2032187..2032777 (-) | Length | 196 a.a. |
| NCBI ID | WP_075232208.1 | Uniprot ID | A0A1E8ZRR0 |
| Organism | Streptococcus sp. DTU_2020_1001019_1_SI_AUS_MUR_006 | ||
| Function | degradation of ComX; degradation of ComW (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2025687..2055948 | 2032187..2032777 | within | 0 |
Gene organization within MGE regions
Location: 2025687..2055948
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RRU92_RS09700 (RRU92_09700) | - | 2025687..2026943 (+) | 1257 | WP_315639098.1 | ISL3 family transposase | - |
| RRU92_RS09705 (RRU92_09705) | - | 2027179..2027889 (-) | 711 | WP_075232203.1 | ABC transporter ATP-binding protein | - |
| RRU92_RS09710 (RRU92_09710) | - | 2027889..2028653 (-) | 765 | WP_075232204.1 | ABC transporter ATP-binding protein | - |
| RRU92_RS09715 (RRU92_09715) | - | 2028653..2029609 (-) | 957 | WP_075232205.1 | branched-chain amino acid ABC transporter permease | - |
| RRU92_RS09720 (RRU92_09720) | - | 2029613..2030482 (-) | 870 | WP_075232206.1 | branched-chain amino acid ABC transporter permease | - |
| RRU92_RS09725 (RRU92_09725) | - | 2030598..2031755 (-) | 1158 | WP_075232207.1 | ABC transporter substrate-binding protein | - |
| RRU92_RS09730 (RRU92_09730) | - | 2031842..2032111 (-) | 270 | WP_049549362.1 | YlbG family protein | - |
| RRU92_RS09735 (RRU92_09735) | clpP | 2032187..2032777 (-) | 591 | WP_075232208.1 | ATP-dependent Clp protease proteolytic subunit ClpP | Regulator |
| RRU92_RS09740 (RRU92_09740) | - | 2032907..2033260 (-) | 354 | WP_075232209.1 | DNA topoisomerase I | - |
| RRU92_RS09745 (RRU92_09745) | upp | 2033285..2033914 (-) | 630 | WP_315639667.1 | uracil phosphoribosyltransferase | - |
| RRU92_RS09750 (RRU92_09750) | - | 2034002..2034469 (-) | 468 | WP_000136981.1 | deoxycytidylate deaminase | - |
| RRU92_RS09755 (RRU92_09755) | - | 2034488..2035045 (-) | 558 | WP_315639670.1 | TetR/AcrR family transcriptional regulator | - |
| RRU92_RS09760 (RRU92_09760) | - | 2035170..2036015 (+) | 846 | WP_153225536.1 | DegV family protein | - |
| RRU92_RS09765 (RRU92_09765) | - | 2036073..2037239 (+) | 1167 | WP_153225291.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| RRU92_RS09770 (RRU92_09770) | - | 2037290..2037811 (+) | 522 | WP_061862833.1 | DUF1697 domain-containing protein | - |
| RRU92_RS09775 (RRU92_09775) | - | 2037822..2038277 (+) | 456 | WP_315639671.1 | 8-oxo-dGTP diphosphatase | - |
| RRU92_RS09780 (RRU92_09780) | - | 2038385..2039125 (-) | 741 | WP_153225293.1 | MerR family transcriptional regulator | - |
| RRU92_RS09785 (RRU92_09785) | - | 2039357..2040697 (+) | 1341 | WP_315639672.1 | sodium-dependent transporter | - |
| RRU92_RS09790 (RRU92_09790) | manA | 2040743..2041687 (-) | 945 | WP_315639673.1 | mannose-6-phosphate isomerase, class I | - |
| RRU92_RS09795 (RRU92_09795) | - | 2041809..2043248 (-) | 1440 | WP_315639675.1 | 6-phospho-beta-glucosidase | - |
| RRU92_RS09800 (RRU92_09800) | - | 2043414..2043992 (-) | 579 | WP_315639677.1 | DUF3592 domain-containing protein | - |
| RRU92_RS09805 (RRU92_09805) | - | 2044136..2044483 (-) | 348 | WP_153225296.1 | VOC family protein | - |
| RRU92_RS09810 (RRU92_09810) | spxB | 2044595..2046370 (-) | 1776 | WP_315639680.1 | pyruvate oxidase | - |
| RRU92_RS09815 (RRU92_09815) | - | 2046694..2048916 (-) | 2223 | WP_315639681.1 | heavy metal translocating P-type ATPase | - |
| RRU92_RS09820 (RRU92_09820) | - | 2048926..2049297 (-) | 372 | WP_315639682.1 | cupredoxin domain-containing protein | - |
| RRU92_RS09825 (RRU92_09825) | - | 2049308..2049703 (-) | 396 | WP_315639683.1 | CopY/TcrY family copper transport repressor | - |
| RRU92_RS09830 (RRU92_09830) | - | 2049907..2050587 (+) | 681 | WP_060956039.1 | amino acid ABC transporter permease | - |
| RRU92_RS09835 (RRU92_09835) | - | 2050547..2051224 (+) | 678 | WP_315639685.1 | amino acid ABC transporter permease | - |
| RRU92_RS09840 (RRU92_09840) | - | 2051225..2051983 (+) | 759 | WP_315639687.1 | amino acid ABC transporter ATP-binding protein | - |
| RRU92_RS09845 (RRU92_09845) | - | 2052002..2052868 (+) | 867 | WP_315639688.1 | cysteine ABC transporter substrate-binding protein | - |
| RRU92_RS09850 (RRU92_09850) | pyrE | 2053045..2053677 (-) | 633 | WP_315639690.1 | orotate phosphoribosyltransferase | - |
| RRU92_RS09855 (RRU92_09855) | pyrF | 2053716..2054417 (-) | 702 | WP_315639691.1 | orotidine-5'-phosphate decarboxylase | - |
| RRU92_RS09860 (RRU92_09860) | - | 2054674..2055948 (-) | 1275 | WP_315639692.1 | cell division protein FtsQ/DivIB | - |
Sequence
Protein
Download Length: 196 a.a. Molecular weight: 21389.39 Da Isoelectric Point: 4.4829
>NTDB_id=886565 RRU92_RS09735 WP_075232208.1 2032187..2032777(-) (clpP) [Streptococcus sp. DTU_2020_1001019_1_SI_AUS_MUR_006]
MIPVVIEQTSRGERSYDIYSRLLKDRIIMLTGPVEDNMANSVIAQLLFLDAQDSTKDIYLYVNTPGGSVSAGLAIVDTMN
FIKADVQTIVMGMAASMGTIIASSGAKGKRFMLPNAEYMIHQPMGGTGGGTQQTDMAIAAEHLLKTRKSLEQILADNSGK
SVEQIHADAERDYWMSAQETLEYGFIDEIMANNSLN
MIPVVIEQTSRGERSYDIYSRLLKDRIIMLTGPVEDNMANSVIAQLLFLDAQDSTKDIYLYVNTPGGSVSAGLAIVDTMN
FIKADVQTIVMGMAASMGTIIASSGAKGKRFMLPNAEYMIHQPMGGTGGGTQQTDMAIAAEHLLKTRKSLEQILADNSGK
SVEQIHADAERDYWMSAQETLEYGFIDEIMANNSLN
Nucleotide
Download Length: 591 bp
>NTDB_id=886565 RRU92_RS09735 WP_075232208.1 2032187..2032777(-) (clpP) [Streptococcus sp. DTU_2020_1001019_1_SI_AUS_MUR_006]
ATGATTCCTGTAGTAATTGAACAAACAAGTCGTGGGGAACGTTCCTACGATATCTACTCTCGTCTTTTGAAAGACCGCAT
CATCATGCTGACAGGTCCAGTTGAAGACAATATGGCAAACTCAGTTATTGCTCAGTTGCTCTTCTTGGATGCTCAAGACA
GCACTAAAGATATCTACCTCTATGTTAATACACCAGGTGGATCAGTTTCAGCTGGTTTGGCAATTGTAGATACTATGAAT
TTCATCAAAGCAGACGTACAAACGATTGTTATGGGTATGGCTGCCTCAATGGGAACTATTATCGCATCAAGTGGTGCTAA
GGGCAAACGCTTCATGCTTCCAAATGCAGAGTACATGATTCACCAACCGATGGGTGGTACTGGTGGTGGTACGCAACAGA
CAGATATGGCTATTGCGGCTGAGCACTTGCTTAAAACTCGTAAGTCTTTGGAGCAAATTCTTGCAGATAATTCTGGTAAA
TCAGTTGAGCAAATCCATGCAGATGCTGAACGTGATTACTGGATGAGCGCTCAAGAAACACTTGAATATGGTTTCATTGA
TGAAATCATGGCTAATAATTCTTTGAATTAA
ATGATTCCTGTAGTAATTGAACAAACAAGTCGTGGGGAACGTTCCTACGATATCTACTCTCGTCTTTTGAAAGACCGCAT
CATCATGCTGACAGGTCCAGTTGAAGACAATATGGCAAACTCAGTTATTGCTCAGTTGCTCTTCTTGGATGCTCAAGACA
GCACTAAAGATATCTACCTCTATGTTAATACACCAGGTGGATCAGTTTCAGCTGGTTTGGCAATTGTAGATACTATGAAT
TTCATCAAAGCAGACGTACAAACGATTGTTATGGGTATGGCTGCCTCAATGGGAACTATTATCGCATCAAGTGGTGCTAA
GGGCAAACGCTTCATGCTTCCAAATGCAGAGTACATGATTCACCAACCGATGGGTGGTACTGGTGGTGGTACGCAACAGA
CAGATATGGCTATTGCGGCTGAGCACTTGCTTAAAACTCGTAAGTCTTTGGAGCAAATTCTTGCAGATAATTCTGGTAAA
TCAGTTGAGCAAATCCATGCAGATGCTGAACGTGATTACTGGATGAGCGCTCAAGAAACACTTGAATATGGTTTCATTGA
TGAAATCATGGCTAATAATTCTTTGAATTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| clpP | Streptococcus pneumoniae Rx1 |
94.898 |
100 |
0.949 |
| clpP | Streptococcus pneumoniae D39 |
94.898 |
100 |
0.949 |
| clpP | Streptococcus pneumoniae R6 |
94.898 |
100 |
0.949 |
| clpP | Streptococcus pneumoniae TIGR4 |
94.898 |
100 |
0.949 |
| clpP | Streptococcus thermophilus LMD-9 |
91.795 |
99.49 |
0.913 |
| clpP | Streptococcus thermophilus LMG 18311 |
91.795 |
99.49 |
0.913 |
| clpP | Streptococcus pyogenes JRS4 |
91.795 |
99.49 |
0.913 |
| clpP | Streptococcus pyogenes MGAS315 |
91.795 |
99.49 |
0.913 |
| clpP | Streptococcus mutans UA159 |
89.231 |
99.49 |
0.888 |
| clpP | Lactococcus lactis subsp. lactis strain DGCC12653 |
88.205 |
99.49 |
0.878 |
| clpP | Lactococcus lactis subsp. cremoris KW2 |
87.692 |
99.49 |
0.872 |
| clpP | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
58.031 |
98.469 |
0.571 |
| clpP | Bacillus subtilis subsp. subtilis str. 168 |
57.292 |
97.959 |
0.561 |