NTDB

Overview

Name	clpP	Type	Regulator
Locus tag	RMQ61_RS07855	Genome accession	NZ_CP135090
Coordinates	1604313..1604903 (-)	Length	196 a.a.
NCBI ID	WP_002937303.1	Uniprot ID	A0A0K2E545
Organism	Streptococcus suis strain ID48908
Function	degradation of ComX (predicted from homology) Competence regulation

Genomic Context

Location: 1599313..1609903

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
RMQ61_RS07830 (RMQ61_07835)	-	1599796..1600560 (-)	765	WP_002937291.1	ABC transporter ATP-binding protein	-
RMQ61_RS07835 (RMQ61_07840)	-	1600560..1601507 (-)	948	WP_002937293.1	branched-chain amino acid ABC transporter permease	-
RMQ61_RS07840 (RMQ61_07845)	-	1601510..1602397 (-)	888	WP_172034037.1	branched-chain amino acid ABC transporter permease	-
RMQ61_RS07845 (RMQ61_07850)	-	1602613..1603782 (-)	1170	WP_014638364.1	ABC transporter substrate-binding protein	-
RMQ61_RS07850 (RMQ61_07855)	-	1603914..1604186 (-)	273	WP_002937299.1	YlbG family protein	-
RMQ61_RS07855 (RMQ61_07860)	clpP	1604313..1604903 (-)	591	WP_002937303.1	ATP-dependent Clp protease proteolytic subunit	Regulator
RMQ61_RS07860 (RMQ61_07865)	upp	1605026..1605655 (-)	630	WP_012027487.1	uracil phosphoribosyltransferase	-
RMQ61_RS07865 (RMQ61_07870)	-	1605735..1607351 (-)	1617	WP_313919422.1	alpha-glucosidase	-
RMQ61_RS07870 (RMQ61_07875)	gtfA	1607424..1608872 (-)	1449	WP_313919424.1	sucrose phosphorylase	-
RMQ61_RS07875 (RMQ61_07880)	-	1608942..1609772 (-)	831	WP_313919426.1	carbohydrate ABC transporter permease	-

Sequence

Protein

Download Length: 196 a.a. Molecular weight: 21494.74 Da Isoelectric Point: 5.7110

                                >NTDB_id=884988 RMQ61_RS07855 WP_002937303.1 1604313..1604903(-) (clpP) [Streptococcus suis strain ID48908]

MIPVVIEQTSRGERSYDIYSRLLKDRIIMLTGPVEDNMANSIIAQLLFLDAQDPTKDIYLYVNTPGGSVSAGLAIVDTMN

FIKADVQTIVMGTAASMGTIIASSGAKGKRFMLPNAEYMIHQPMGGTGGGTQQTDMAIAAEHLLKTRNKLEKILADNSGK

TVKQIHKDAERDYWMSAEETLAYGFIDQIMDNTKVK

Nucleotide

Download Length: 591 bp

                                >NTDB_id=884988 RMQ61_RS07855 WP_002937303.1 1604313..1604903(-) (clpP) [Streptococcus suis strain ID48908]

ATGATTCCAGTAGTTATTGAACAAACTAGCCGTGGTGAGCGTTCTTATGATATTTACTCACGCCTCTTGAAAGACCGCAT

TATCATGTTGACAGGACCAGTTGAGGACAACATGGCTAATTCGATTATTGCACAATTGCTTTTCCTTGATGCCCAAGATC

CTACAAAGGATATTTACCTCTATGTTAATACGCCAGGAGGATCGGTGTCAGCAGGTCTTGCCATTGTAGACACGATGAAT

TTCATTAAAGCAGATGTTCAAACCATCGTCATGGGGACAGCTGCCAGCATGGGTACAATTATCGCTTCAAGTGGTGCCAA

AGGCAAACGTTTCATGTTGCCAAATGCGGAATACATGATTCACCAACCAATGGGTGGAACAGGTGGCGGTACACAGCAAA

CGGACATGGCTATTGCAGCAGAACACCTATTAAAAACACGTAATAAGCTAGAAAAAATCTTGGCAGACAACTCAGGTAAG

ACAGTCAAGCAAATCCACAAGGATGCAGAACGTGATTACTGGATGTCAGCAGAAGAAACCTTGGCTTACGGATTTATTGA

CCAGATTATGGACAATACAAAAGTCAAATAA

Domains

Predicted by InterproScan.

Clp protease (CLP_protease)

(11-192)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A0K2E545

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
clpP	Streptococcus pyogenes JRS4	92.347	100	0.923
clpP	Streptococcus pyogenes MGAS315	92.347	100	0.923
clpP	Streptococcus mutans UA159	90.306	100	0.903
clpP	Streptococcus pneumoniae R6	88.776	100	0.888
clpP	Streptococcus pneumoniae Rx1	88.776	100	0.888
clpP	Streptococcus pneumoniae D39	88.776	100	0.888
clpP	Streptococcus pneumoniae TIGR4	88.776	100	0.888
clpP	Streptococcus thermophilus LMG 18311	88.776	100	0.888
clpP	Streptococcus thermophilus LMD-9	88.776	100	0.888
clpP	Lactococcus lactis subsp. lactis strain DGCC12653	84.184	100	0.842
clpP	Lactococcus lactis subsp. cremoris KW2	83.673	100	0.837
clpP	Bacillus subtilis subsp. subtilis str. 168	58.163	100	0.582
clpP	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	58.549	98.469	0.577

Detailed information NTG0884988