Detailed information NTG0884863

Bioinformatically predicted

Overview

• Name: comGF/cglF
• Type: Machinery gene
• Locus tag: RMP67_RS00915
• Genome accession: NZ_CP135087
• Coordinates: 158002..158436 (+)
• Length: 144 a.a.
• NCBI ID: WP_024395445.1
• Uniprot ID: -
• Organism: Streptococcus suis strain ID26102
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 153002..163436

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
RMP67_RS00880 (RMP67_00880)	tnpA	153441..153915 (-)	475	Protein_139	IS200/IS605 family transposase	-
RMP67_RS00885 (RMP67_00885)	-	154144..155094 (-)	951	WP_313920908.1	LD-carboxypeptidase	-
RMP67_RS00890 (RMP67_00890)	comYA	155180..156130 (+)	951	WP_105140681.1	competence type IV pilus ATPase ComGA	Machinery gene
RMP67_RS00895 (RMP67_00895)	comYB	156042..157079 (+)	1038	WP_313921433.1	competence type IV pilus assembly protein ComGB	Machinery gene
RMP67_RS00900 (RMP67_00900)	comYC	157081..157362 (+)	282	WP_313920909.1	competence type IV pilus major pilin ComGC	Machinery gene
RMP67_RS00905 (RMP67_00905)	comGD	157343..157750 (+)	408	WP_313920910.1	competence type IV pilus minor pilin ComGD	-
RMP67_RS00910 (RMP67_00910)	comYE	157722..158015 (+)	294	WP_024413203.1	competence type IV pilus minor pilin ComGE	Machinery gene
RMP67_RS00915 (RMP67_00915)	comGF/cglF	158002..158436 (+)	435	WP_024395445.1	competence type IV pilus minor pilin ComGF	Machinery gene
RMP67_RS00920 (RMP67_00920)	comGG	158414..158941 (+)	528	WP_313920911.1	competence type IV pilus minor pilin ComGG	-
RMP67_RS00925 (RMP67_00925)	comYH	158997..159950 (+)	954	WP_105105703.1	class I SAM-dependent methyltransferase	Machinery gene
RMP67_RS00930 (RMP67_00930)	-	160000..161187 (+)	1188	WP_313920912.1	acetate kinase	-
RMP67_RS00935 (RMP67_00935)	-	161263..162126 (-)	864	WP_313920913.1	IS982 family transposase	-
RMP67_RS00940 (RMP67_00940)	-	162471..162644 (+)	174	WP_313920914.1	hypothetical protein	-
RMP67_RS00945 (RMP67_00945)	-	162684..163022 (+)	339	WP_398584275.1	folate family ECF transporter S component	-

Sequence

Protein

• Length: 144 a.a.
• Molecular weight: 16433.77 Da
• Isoelectric Point: 6.9832

>NTDB_id=884863 RMP67_RS00915 WP_024395445.1 158002..158436(+) (comGF/cglF) [Streptococcus suis strain ID26102]
MLKSKIPAFTLLECLVALIILSGSLLVFEGLSKLLVQEAHYQGQTVQKEWLVFSSQLRSEWDQAELVKVENGKVYVNKGE
QALAFGKSRSDDFRKTNDRGQGYQPMLYQVDSAAISQENQLVRIDFSFKNGEERTFIYAFKEKS

Nucleotide

• Length: 435 bp

>NTDB_id=884863 RMP67_RS00915 WP_024395445.1 158002..158436(+) (comGF/cglF) [Streptococcus suis strain ID26102]
TTGTTAAAAAGTAAAATTCCTGCTTTTACTCTCTTGGAATGCTTGGTAGCTTTAATCATCCTATCAGGAAGTCTTCTGGT
CTTTGAAGGCTTGTCAAAACTGCTGGTCCAAGAAGCGCATTATCAAGGTCAGACCGTTCAAAAGGAATGGTTGGTCTTCT
CTAGTCAATTGCGGTCGGAGTGGGACCAGGCTGAATTGGTCAAGGTTGAAAATGGCAAGGTCTATGTCAACAAAGGTGAA
CAGGCTTTGGCCTTTGGCAAGTCACGGTCGGATGATTTTCGGAAAACAAATGATAGAGGCCAGGGTTACCAACCCATGCT
CTATCAGGTGGACAGCGCAGCCATTTCCCAAGAAAACCAGCTGGTGCGTATTGACTTTAGCTTTAAAAATGGAGAGGAGC
GGACCTTTATCTATGCTTTTAAAGAAAAAAGTTAA

Domains

Predicted by InterproScan.

• Putative Competence protein ComGF (ComGF) (37-134)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGF/cglF	Streptococcus pneumoniae TIGR4	53.901	97.917	0.528
comGF/cglF	Streptococcus pneumoniae Rx1	53.901	97.917	0.528
comGF/cglF	Streptococcus pneumoniae D39	53.901	97.917	0.528
comGF/cglF	Streptococcus pneumoniae R6	53.901	97.917	0.528
comGF/cglF	Streptococcus mitis NCTC 12261	54.478	93.056	0.507
comYF	Streptococcus mutans UA140	50	100	0.5
comYF	Streptococcus mutans UA159	49.306	100	0.493
comGF/cglF	Streptococcus mitis SK321	51.493	93.056	0.479
comGF	Lactococcus lactis subsp. cremoris KW2	46.809	97.917	0.458