Detailed information    

insolico Bioinformatically predicted

Overview


Name   prx   Type   Regulator
Locus tag   QN282_RS03015 Genome accession   NZ_CP134689
Coordinates   541514..541702 (+) Length   62 a.a.
NCBI ID   WP_000027835.1    Uniprot ID   A0AAV3JNT7
Organism   Streptococcus agalactiae strain HU05/19     
Function   Inhibit ComR activation (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 531866..589909 541514..541702 within 0
IS/Tn 540447..541058 541514..541702 flank 456


Gene organization within MGE regions


Location: 531866..589909
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QN282_RS02965 (QN282_02955) - 532283..532549 (-) 267 WP_001872365.1 hypothetical protein -
  QN282_RS02970 (QN282_02960) - 532555..533932 (+) 1378 Protein_534 IS3 family transposase -
  QN282_RS02975 (QN282_02965) - 534105..534268 (-) 164 Protein_535 TM2 domain-containing protein -
  QN282_RS02980 (QN282_02970) - 535010..536287 (+) 1278 WP_000594360.1 ABC transporter permease -
  QN282_RS02985 (QN282_02975) - 536297..536953 (+) 657 WP_000353149.1 ABC transporter ATP-binding protein -
  QN282_RS02990 (QN282_02980) - 536953..538329 (+) 1377 WP_000594351.1 ABC transporter permease -
  QN282_RS02995 (QN282_02985) - 538426..539079 (+) 654 WP_000699093.1 response regulator transcription factor -
  QN282_RS03000 (QN282_02990) - 539076..540395 (+) 1320 WP_000734169.1 sensor histidine kinase -
  QN282_RS03005 (QN282_02995) - 540447..541094 (-) 648 Protein_541 IS3 family transposase -
  QN282_RS03010 (QN282_03000) - 541272..541472 (+) 201 WP_000076708.1 CsbD family protein -
  QN282_RS03015 (QN282_03005) prx 541514..541702 (+) 189 WP_000027835.1 hypothetical protein Regulator
  QN282_RS03020 (QN282_03010) - 542127..543332 (+) 1206 WP_000078931.1 FtsW/RodA/SpoVE family cell cycle protein -
  QN282_RS03025 (QN282_03015) - 543451..544011 (+) 561 WP_001106189.1 HAD-IA family hydrolase -
  QN282_RS03030 (QN282_03020) gyrB 544012..545964 (+) 1953 WP_000134196.1 DNA topoisomerase (ATP-hydrolyzing) subunit B -
  QN282_RS03035 (QN282_03025) ezrA 546058..547782 (+) 1725 WP_000094341.1 septation ring formation regulator EzrA -
  QN282_RS03040 (QN282_03030) serB 547876..548517 (+) 642 WP_000589685.1 phosphoserine phosphatase SerB -
  QN282_RS03045 (QN282_03035) - 548538..549023 (-) 486 WP_000409124.1 NUDIX hydrolase -
  QN282_RS03050 (QN282_03040) - 549036..549491 (-) 456 WP_000137373.1 YueI family protein -
  QN282_RS03055 (QN282_03045) eno 549689..550996 (+) 1308 WP_000022832.1 surface-displayed alpha-enolase -
  QN282_RS03060 (QN282_03050) - 551104..552168 (-) 1065 WP_000823934.1 DNA/RNA non-specific endonuclease -
  QN282_RS03065 (QN282_03055) aroA 552397..553680 (+) 1284 WP_000772014.1 3-phosphoshikimate 1-carboxyvinyltransferase -
  QN282_RS03070 (QN282_03060) - 553673..554185 (+) 513 WP_001127193.1 shikimate kinase -
  QN282_RS03075 (QN282_03065) - 554242..555615 (+) 1374 WP_000089337.1 LCP family protein -
  QN282_RS03080 (QN282_03070) rlmD 555716..557347 (+) 1632 WP_410531128.1 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD -
  QN282_RS03085 (QN282_03075) - 557366..557647 (+) 282 WP_410531129.1 CD1845 family protein -
  QN282_RS03090 (QN282_03080) - 557738..558508 (+) 771 WP_155961752.1 replication initiator protein A -
  QN282_RS03095 (QN282_03085) - 558505..559379 (+) 875 Protein_559 ATP-binding protein -
  QN282_RS03100 (QN282_03090) - 559376..559861 (+) 486 WP_055328033.1 PcfB family protein -
  QN282_RS03105 (QN282_03095) - 559858..560901 (+) 1044 WP_410531130.1 type IV secretory system conjugative DNA transfer family protein -
  QN282_RS03110 (QN282_03100) - 560941..562779 (+) 1839 WP_001243448.1 recombinase family protein -
  QN282_RS03115 (QN282_03105) - 562855..563427 (+) 573 WP_000079884.1 TetR/AcrR family transcriptional regulator -
  QN282_RS03120 (QN282_03110) - 563478..563996 (+) 519 WP_000708365.1 ClbS/DfsB family four-helix bundle protein -
  QN282_RS03125 (QN282_03115) - 564137..565876 (+) 1740 WP_001114256.1 ABC transporter ATP-binding protein -
  QN282_RS03130 (QN282_03120) - 565869..567578 (+) 1710 WP_000488162.1 ABC transporter ATP-binding protein -
  QN282_RS03135 (QN282_03125) - 567581..569098 (+) 1518 WP_000601967.1 ABC transporter ATP-binding protein -
  QN282_RS03140 (QN282_03130) - 569088..569792 (+) 705 WP_000567178.1 energy-coupling factor transporter transmembrane component T -
  QN282_RS03145 (QN282_03135) - 569803..570387 (+) 585 WP_000791750.1 MptD family putative ECF transporter S component -
  QN282_RS03150 (QN282_03140) - 570653..571069 (+) 417 WP_001074478.1 sigma factor-like helix-turn-helix DNA-binding protein -
  QN282_RS03155 (QN282_03145) - 571154..571483 (+) 330 WP_000712033.1 DUF3847 domain-containing protein -
  QN282_RS03160 (QN282_03150) mobQ 571728..573380 (+) 1653 WP_000852174.1 MobQ family relaxase -
  QN282_RS03165 (QN282_03155) - 573383..574135 (+) 753 WP_004830091.1 phage replisome organizer N-terminal domain-containing protein -
  QN282_RS03170 (QN282_03160) - 574309..574632 (+) 324 WP_004830093.1 hypothetical protein -
  QN282_RS03175 (QN282_03165) - 574654..575661 (+) 1008 WP_000797009.1 ORF6N domain-containing protein -
  QN282_RS03180 (QN282_03170) - 575771..575956 (+) 186 WP_001005000.1 transposon-encoded TnpW family protein -
  QN282_RS03185 (QN282_03175) - 575968..576780 (+) 813 Protein_577 VirD4-like conjugal transfer protein, CD1115 family -
  QN282_RS03190 (QN282_03180) - 576941..577252 (+) 312 WP_338176108.1 single-stranded DNA-binding protein -
  QN282_RS03195 (QN282_03185) - 577256..577471 (+) 216 WP_000394208.1 Maff2 family mobile element protein -
  QN282_RS03200 (QN282_03190) - 577491..578354 (+) 864 WP_000466901.1 VirB6/TrbL-like conjugal transfer protein, CD1112 family -
  QN282_RS03205 (QN282_03195) - 578372..578635 (+) 264 WP_001042374.1 hypothetical protein -
  QN282_RS03210 (QN282_03200) - 578639..579028 (+) 390 WP_000332197.1 PrgI family protein -
  QN282_RS03215 (QN282_03205) - 578940..581369 (+) 2430 WP_410531131.1 VirB4-like conjugal transfer ATPase, CD1110 family -
  QN282_RS03220 (QN282_03210) - 581374..583527 (+) 2154 WP_410531132.1 CD1108 family mobile element protein -
  QN282_RS03225 (QN282_03215) - 583540..583776 (+) 237 WP_047200382.1 hypothetical protein -
  QN282_RS03230 (QN282_03220) - 583754..585940 (+) 2187 WP_410531133.1 CD1107 family mobile element protein -
  QN282_RS03235 (QN282_03225) - 586038..587744 (+) 1707 WP_410531134.1 DNA topoisomerase 3 -
  QN282_RS03240 (QN282_03230) - 587826..589361 (+) 1536 WP_001176344.1 helix-turn-helix domain-containing protein -

Sequence


Protein


Download         Length: 62 a.a.        Molecular weight: 7180.25 Da        Isoelectric Point: 4.7815

>NTDB_id=882805 QN282_RS03015 WP_000027835.1 541514..541702(+) (prx) [Streptococcus agalactiae strain HU05/19]
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS

Nucleotide


Download         Length: 189 bp        

>NTDB_id=882805 QN282_RS03015 WP_000027835.1 541514..541702(+) (prx) [Streptococcus agalactiae strain HU05/19]
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  prx Streptococcus pyogenes MGAS315

72.222

87.097

0.629

  prx Streptococcus pyogenes MGAS8232

69.091

88.71

0.613

  prx Streptococcus pyogenes MGAS315

66.667

87.097

0.581

  prx Streptococcus pyogenes MGAS315

85

64.516

0.548

  prx Streptococcus pyogenes MGAS315

61.818

88.71

0.548

  prx Streptococcus pyogenes MGAS315

74.359

62.903

0.468

  prx Streptococcus pyogenes MGAS315

78.378

59.677

0.468