Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | RLO20_RS08015 | Genome accession | NZ_CP134538 |
| Coordinates | 1688403..1688588 (-) | Length | 61 a.a. |
| NCBI ID | WP_012679954.1 | Uniprot ID | C0M6G1 |
| Organism | Streptococcus equi subsp. equi strain XJ5012 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1688403..1719185 | 1688403..1688588 | within | 0 |
Gene organization within MGE regions
Location: 1688403..1719185
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RLO20_RS08015 (RLO20_08015) | prx | 1688403..1688588 (-) | 186 | WP_012679954.1 | hypothetical protein | Regulator |
| RLO20_RS08020 (RLO20_08020) | spel | 1688710..1689498 (-) | 789 | WP_012679955.1 | streptococcal pyrogenic exotoxin SpeL | - |
| RLO20_RS08025 (RLO20_08025) | spek | 1689765..1690544 (-) | 780 | WP_012679956.1 | streptococcal pyrogenic exotoxin SpeK | - |
| RLO20_RS08030 (RLO20_08030) | - | 1690669..1691898 (-) | 1230 | WP_012679957.1 | glucosaminidase domain-containing protein | - |
| RLO20_RS08035 (RLO20_08035) | - | 1692010..1692189 (-) | 180 | WP_012679339.1 | holin | - |
| RLO20_RS08040 (RLO20_08040) | - | 1692192..1692482 (-) | 291 | WP_317608656.1 | hypothetical protein | - |
| RLO20_RS08045 (RLO20_08045) | - | 1692495..1693109 (-) | 615 | WP_012679958.1 | DUF1366 domain-containing protein | - |
| RLO20_RS08050 (RLO20_08050) | - | 1693112..1693543 (-) | 432 | WP_050316147.1 | DUF1617 family protein | - |
| RLO20_RS08055 (RLO20_08055) | - | 1693552..1695456 (-) | 1905 | WP_012679960.1 | gp58-like family protein | - |
| RLO20_RS08060 (RLO20_08060) | - | 1695467..1696081 (-) | 615 | WP_012679961.1 | hypothetical protein | - |
| RLO20_RS08065 (RLO20_08065) | - | 1696083..1696790 (-) | 708 | WP_012679962.1 | collagen-like protein | - |
| RLO20_RS08070 (RLO20_08070) | - | 1696790..1698847 (-) | 2058 | WP_317608657.1 | phage tail spike protein | - |
| RLO20_RS08075 (RLO20_08075) | - | 1698844..1699623 (-) | 780 | WP_012679964.1 | distal tail protein Dit | - |
| RLO20_RS08080 (RLO20_08080) | - | 1699655..1702909 (-) | 3255 | WP_317608658.1 | tape measure protein | - |
| RLO20_RS08085 (RLO20_08085) | - | 1702926..1703255 (-) | 330 | WP_012679966.1 | hypothetical protein | - |
| RLO20_RS08090 (RLO20_08090) | - | 1703297..1703656 (-) | 360 | WP_012679967.1 | tail assembly chaperone | - |
| RLO20_RS08095 (RLO20_08095) | - | 1703718..1704243 (-) | 526 | Protein_1567 | phage major tail protein, TP901-1 family | - |
| RLO20_RS08100 (RLO20_08100) | - | 1704319..1704708 (-) | 390 | WP_012679970.1 | hypothetical protein | - |
| RLO20_RS08105 (RLO20_08105) | - | 1704705..1705070 (-) | 366 | WP_012679971.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| RLO20_RS08110 (RLO20_08110) | - | 1705051..1705359 (-) | 309 | WP_012679972.1 | hypothetical protein | - |
| RLO20_RS08115 (RLO20_08115) | - | 1705356..1705709 (-) | 354 | WP_012679973.1 | phage head-tail connector protein | - |
| RLO20_RS08120 (RLO20_08120) | - | 1705719..1705985 (-) | 267 | WP_012679974.1 | HeH/LEM domain-containing protein | - |
| RLO20_RS08125 (RLO20_08125) | - | 1705996..1707045 (-) | 1050 | WP_012679975.1 | major capsid protein | - |
| RLO20_RS08130 (RLO20_08130) | - | 1707048..1707428 (-) | 381 | WP_012679976.1 | head decoration protein | - |
| RLO20_RS08135 (RLO20_08135) | - | 1707439..1708062 (-) | 624 | WP_042357153.1 | DUF4355 domain-containing protein | - |
| RLO20_RS08140 (RLO20_08140) | - | 1708244..1708411 (-) | 168 | WP_012679978.1 | hypothetical protein | - |
| RLO20_RS08145 (RLO20_08145) | - | 1708447..1708716 (-) | 270 | WP_012679979.1 | hypothetical protein | - |
| RLO20_RS08150 (RLO20_08150) | - | 1708913..1709332 (-) | 420 | WP_012679981.1 | HD domain-containing protein | - |
| RLO20_RS08155 (RLO20_08155) | - | 1709329..1709535 (-) | 207 | WP_003052398.1 | hypothetical protein | - |
| RLO20_RS08160 (RLO20_08160) | - | 1709537..1711102 (-) | 1566 | WP_012679982.1 | minor capsid protein | - |
| RLO20_RS08165 (RLO20_08165) | - | 1711095..1712597 (-) | 1503 | WP_012679983.1 | phage portal protein | - |
| RLO20_RS08170 (RLO20_08170) | - | 1712609..1713856 (-) | 1248 | WP_012679984.1 | PBSX family phage terminase large subunit | - |
| RLO20_RS08180 (RLO20_08180) | - | 1715448..1716236 (+) | 789 | WP_012679985.1 | helix-turn-helix transcriptional regulator | - |
| RLO20_RS08185 (RLO20_08185) | - | 1716245..1717414 (+) | 1170 | WP_012679986.1 | DUF4041 domain-containing protein | - |
| RLO20_RS08190 (RLO20_08190) | - | 1717417..1717620 (+) | 204 | WP_012679987.1 | hypothetical protein | - |
| RLO20_RS08195 (RLO20_08195) | - | 1717752..1719185 (+) | 1434 | WP_012679988.1 | recombinase family protein | - |
Sequence
Protein
Download Length: 61 a.a. Molecular weight: 6981.00 Da Isoelectric Point: 3.8428
>NTDB_id=880866 RLO20_RS08015 WP_012679954.1 1688403..1688588(-) (prx) [Streptococcus equi subsp. equi strain XJ5012]
MLTYEEFKQAIDHGYITGDVVMIVRKNGQIFDYVLPGEEVQPWEVVTVEAVADILNELQII
MLTYEEFKQAIDHGYITGDVVMIVRKNGQIFDYVLPGEEVQPWEVVTVEAVADILNELQII
Nucleotide
Download Length: 186 bp
>NTDB_id=880866 RLO20_RS08015 WP_012679954.1 1688403..1688588(-) (prx) [Streptococcus equi subsp. equi strain XJ5012]
ATGCTAACATACGAGGAATTTAAGCAAGCTATTGATCATGGATATATCACAGGAGACGTGGTCATGATCGTGCGTAAAAA
CGGACAGATATTTGATTATGTGTTGCCAGGGGAGGAAGTGCAGCCTTGGGAAGTGGTGACAGTCGAGGCAGTTGCTGATA
TTTTAAACGAATTACAAATTATTTGA
ATGCTAACATACGAGGAATTTAAGCAAGCTATTGATCATGGATATATCACAGGAGACGTGGTCATGATCGTGCGTAAAAA
CGGACAGATATTTGATTATGTGTTGCCAGGGGAGGAAGTGCAGCCTTGGGAAGTGGTGACAGTCGAGGCAGTTGCTGATA
TTTTAAACGAATTACAAATTATTTGA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
74.138 |
95.082 |
0.705 |
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
96.721 |
0.672 |
| prx | Streptococcus pyogenes MGAS8232 |
69.492 |
96.721 |
0.672 |
| prx | Streptococcus pyogenes MGAS315 |
67.241 |
95.082 |
0.639 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
68.852 |
0.574 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
67.213 |
0.557 |
| prx | Streptococcus pyogenes MGAS315 |
70.732 |
67.213 |
0.475 |