Detailed information
Bioinformatically predicted
Overview
| Name | clpP | Type | Regulator |
| Locus tag | RJW56_RS07825 | Genome accession | NZ_CP134472 |
| Coordinates | 1577740..1578330 (-) | Length | 196 a.a. |
| NCBI ID | WP_002937303.1 | Uniprot ID | A0A0K2E545 |
| Organism | Streptococcus suis strain 1522228 | ||
| Function | degradation of ComX (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1525724..1578330 | 1577740..1578330 | within | 0 |
Gene organization within MGE regions
Location: 1525724..1578330
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RJW56_RS07445 (RJW56_07445) | - | 1525724..1526668 (-) | 945 | WP_024395069.1 | bifunctional oligoribonuclease/PAP phosphatase NrnA | - |
| RJW56_RS07450 (RJW56_07450) | - | 1526763..1527224 (+) | 462 | WP_024395068.1 | flavodoxin | - |
| RJW56_RS07455 (RJW56_07455) | rpsN | 1527365..1527634 (+) | 270 | WP_002940393.1 | 30S ribosomal protein S14 | - |
| RJW56_RS07460 (RJW56_07460) | - | 1527716..1527994 (+) | 279 | WP_024381604.1 | chorismate mutase | - |
| RJW56_RS07465 (RJW56_07465) | - | 1527984..1529198 (+) | 1215 | WP_032533014.1 | chloride channel protein | - |
| RJW56_RS07470 (RJW56_07470) | - | 1529651..1530028 (-) | 378 | WP_024394270.1 | PBECR2 nuclease fold domain-containing protein | - |
| RJW56_RS07475 (RJW56_07475) | - | 1530093..1530830 (-) | 738 | WP_172051272.1 | PlySs2 family phage lysin | - |
| RJW56_RS07480 (RJW56_07480) | - | 1530814..1531164 (-) | 351 | WP_002937841.1 | phage holin | - |
| RJW56_RS07485 (RJW56_07485) | - | 1531167..1531466 (-) | 300 | WP_014636661.1 | hypothetical protein | - |
| RJW56_RS07490 (RJW56_07490) | - | 1531470..1531814 (-) | 345 | WP_002937844.1 | hypothetical protein | - |
| RJW56_RS07495 (RJW56_07495) | - | 1531817..1532035 (-) | 219 | WP_002937846.1 | hypothetical protein | - |
| RJW56_RS07500 (RJW56_07500) | - | 1532044..1537353 (-) | 5310 | WP_172051271.1 | phage tail spike protein | - |
| RJW56_RS07505 (RJW56_07505) | - | 1537350..1538045 (-) | 696 | WP_002937853.1 | adenylosuccinate synthetase | - |
| RJW56_RS07510 (RJW56_07510) | - | 1538045..1540627 (-) | 2583 | WP_024417667.1 | hypothetical protein | - |
| RJW56_RS07515 (RJW56_07515) | - | 1540617..1541000 (-) | 384 | WP_002937861.1 | DUF5361 domain-containing protein | - |
| RJW56_RS07520 (RJW56_07520) | - | 1540997..1541275 (-) | 279 | WP_002937863.1 | hypothetical protein | - |
| RJW56_RS07525 (RJW56_07525) | - | 1541286..1541873 (-) | 588 | WP_002937867.1 | hypothetical protein | - |
| RJW56_RS07530 (RJW56_07530) | - | 1541889..1542224 (-) | 336 | WP_002937874.1 | hypothetical protein | - |
| RJW56_RS07535 (RJW56_07535) | - | 1542221..1542460 (-) | 240 | WP_002937877.1 | hypothetical protein | - |
| RJW56_RS07540 (RJW56_07540) | - | 1542453..1542791 (-) | 339 | WP_002937879.1 | hypothetical protein | - |
| RJW56_RS07545 (RJW56_07545) | - | 1542778..1543173 (-) | 396 | WP_002937880.1 | phage Gp19/Gp15/Gp42 family protein | - |
| RJW56_RS07550 (RJW56_07550) | - | 1543177..1543401 (-) | 225 | WP_002937881.1 | HeH/LEM domain-containing protein | - |
| RJW56_RS07555 (RJW56_07555) | - | 1543403..1544305 (-) | 903 | WP_002937882.1 | phage major capsid protein | - |
| RJW56_RS07560 (RJW56_07560) | - | 1544320..1544790 (-) | 471 | WP_002937883.1 | DUF4355 domain-containing protein | - |
| RJW56_RS07565 (RJW56_07565) | - | 1544873..1546288 (-) | 1416 | WP_002937884.1 | terminase | - |
| RJW56_RS07570 (RJW56_07570) | - | 1546433..1546564 (-) | 132 | WP_002937886.1 | hypothetical protein | - |
| RJW56_RS07575 (RJW56_07575) | - | 1546633..1546845 (-) | 213 | WP_002937901.1 | hypothetical protein | - |
| RJW56_RS07580 (RJW56_07580) | - | 1546842..1547921 (-) | 1080 | WP_002937903.1 | hypothetical protein | - |
| RJW56_RS07585 (RJW56_07585) | - | 1547914..1549179 (-) | 1266 | WP_002937907.1 | phage portal protein | - |
| RJW56_RS07590 (RJW56_07590) | - | 1549176..1549538 (-) | 363 | WP_002937910.1 | hypothetical protein | - |
| RJW56_RS07595 (RJW56_07595) | - | 1549617..1549964 (-) | 348 | WP_002937914.1 | HNH endonuclease | - |
| RJW56_RS07600 (RJW56_07600) | - | 1550061..1550495 (-) | 435 | WP_002937915.1 | DUF1492 domain-containing protein | - |
| RJW56_RS07605 (RJW56_07605) | - | 1550572..1550823 (-) | 252 | WP_002937919.1 | hypothetical protein | - |
| RJW56_RS07610 (RJW56_07610) | - | 1550896..1551743 (+) | 848 | WP_141669245.1 | IS630 family transposase | - |
| RJW56_RS07615 (RJW56_07615) | - | 1551736..1552002 (-) | 267 | WP_172051244.1 | hypothetical protein | - |
| RJW56_RS07620 (RJW56_07620) | - | 1552002..1552178 (-) | 177 | WP_002937925.1 | hypothetical protein | - |
| RJW56_RS07625 (RJW56_07625) | - | 1552178..1552411 (-) | 234 | WP_002937935.1 | hypothetical protein | - |
| RJW56_RS07630 (RJW56_07630) | - | 1552427..1552729 (-) | 303 | WP_002937939.1 | DUF1372 family protein | - |
| RJW56_RS07635 (RJW56_07635) | - | 1552739..1553257 (-) | 519 | WP_002937943.1 | hypothetical protein | - |
| RJW56_RS07640 (RJW56_07640) | - | 1553254..1553586 (-) | 333 | WP_002937944.1 | hypothetical protein | - |
| RJW56_RS07645 (RJW56_07645) | - | 1553899..1554273 (-) | 375 | WP_002937949.1 | hypothetical protein | - |
| RJW56_RS07650 (RJW56_07650) | ssb | 1554301..1554762 (-) | 462 | WP_002937951.1 | single-stranded DNA-binding protein | Machinery gene |
| RJW56_RS07655 (RJW56_07655) | - | 1554865..1555044 (-) | 180 | WP_002937955.1 | hypothetical protein | - |
| RJW56_RS07660 (RJW56_07660) | - | 1555034..1555360 (-) | 327 | WP_002937956.1 | hypothetical protein | - |
| RJW56_RS07665 (RJW56_07665) | - | 1555370..1555639 (-) | 270 | WP_002937957.1 | hypothetical protein | - |
| RJW56_RS07670 (RJW56_07670) | - | 1555642..1556670 (-) | 1029 | WP_014636674.1 | DUF1351 domain-containing protein | - |
| RJW56_RS07675 (RJW56_07675) | bet | 1556680..1557450 (-) | 771 | WP_014636675.1 | phage recombination protein Bet | - |
| RJW56_RS07680 (RJW56_07680) | - | 1557447..1557626 (-) | 180 | WP_004195116.1 | hypothetical protein | - |
| RJW56_RS07685 (RJW56_07685) | - | 1557626..1557754 (-) | 129 | WP_014636676.1 | hypothetical protein | - |
| RJW56_RS07690 (RJW56_07690) | - | 1557765..1557908 (-) | 144 | WP_014636677.1 | hypothetical protein | - |
| RJW56_RS07695 (RJW56_07695) | - | 1558167..1558532 (-) | 366 | WP_004194647.1 | hypothetical protein | - |
| RJW56_RS07700 (RJW56_07700) | - | 1558585..1558809 (-) | 225 | WP_004194648.1 | hypothetical protein | - |
| RJW56_RS07705 (RJW56_07705) | - | 1558790..1559047 (-) | 258 | WP_014636678.1 | hypothetical protein | - |
| RJW56_RS07710 (RJW56_07710) | - | 1559402..1560112 (-) | 711 | WP_014636680.1 | phage antirepressor KilAC domain-containing protein | - |
| RJW56_RS07715 (RJW56_07715) | - | 1560166..1560855 (+) | 690 | WP_014636681.1 | DUF4145 domain-containing protein | - |
| RJW56_RS07720 (RJW56_07720) | - | 1560951..1561172 (-) | 222 | WP_004195135.1 | hypothetical protein | - |
| RJW56_RS07725 (RJW56_07725) | - | 1561232..1561441 (-) | 210 | WP_024395040.1 | transcriptional regulator | - |
| RJW56_RS07730 (RJW56_07730) | - | 1561448..1561639 (-) | 192 | WP_024390858.1 | helix-turn-helix transcriptional regulator | - |
| RJW56_RS07735 (RJW56_07735) | - | 1561782..1562006 (+) | 225 | WP_024377139.1 | DUF2188 domain-containing protein | - |
| RJW56_RS07740 (RJW56_07740) | - | 1562003..1562143 (-) | 141 | WP_125064532.1 | hypothetical protein | - |
| RJW56_RS07745 (RJW56_07745) | - | 1562567..1562713 (-) | 147 | WP_153308637.1 | hypothetical protein | - |
| RJW56_RS07750 (RJW56_07750) | - | 1562887..1563630 (+) | 744 | WP_172051243.1 | XRE family transcriptional regulator | - |
| RJW56_RS07755 (RJW56_07755) | - | 1563699..1564535 (+) | 837 | WP_024395036.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| RJW56_RS07760 (RJW56_07760) | - | 1565180..1566268 (+) | 1089 | WP_125169320.1 | tyrosine-type recombinase/integrase | - |
| RJW56_RS07770 (RJW56_07770) | - | 1566579..1568603 (-) | 2025 | WP_023370923.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
| RJW56_RS07775 (RJW56_07775) | sodA | 1568865..1569470 (-) | 606 | WP_024381607.1 | superoxide dismutase SodA | - |
| RJW56_RS07780 (RJW56_07780) | holA | 1569583..1570614 (-) | 1032 | WP_024381608.1 | DNA polymerase III subunit delta | - |
| RJW56_RS07785 (RJW56_07785) | - | 1570764..1571354 (-) | 591 | WP_013730461.1 | hypothetical protein | - |
| RJW56_RS07790 (RJW56_07790) | - | 1571462..1572217 (-) | 756 | WP_002937287.1 | epoxyqueuosine reductase QueH | - |
| RJW56_RS07795 (RJW56_07795) | - | 1572524..1573234 (-) | 711 | WP_002937288.1 | ABC transporter ATP-binding protein | - |
| RJW56_RS07800 (RJW56_07800) | - | 1573234..1573998 (-) | 765 | WP_002937291.1 | ABC transporter ATP-binding protein | - |
| RJW56_RS07805 (RJW56_07805) | - | 1573998..1574945 (-) | 948 | WP_002937293.1 | branched-chain amino acid ABC transporter permease | - |
| RJW56_RS07810 (RJW56_07810) | - | 1574948..1575835 (-) | 888 | WP_002937296.1 | branched-chain amino acid ABC transporter permease | - |
| RJW56_RS07815 (RJW56_07815) | - | 1576041..1577210 (-) | 1170 | WP_002937297.1 | ABC transporter substrate-binding protein | - |
| RJW56_RS07820 (RJW56_07820) | - | 1577341..1577613 (-) | 273 | WP_002937299.1 | YlbG family protein | - |
| RJW56_RS07825 (RJW56_07825) | clpP | 1577740..1578330 (-) | 591 | WP_002937303.1 | ATP-dependent Clp protease proteolytic subunit | Regulator |
Sequence
Protein
Download Length: 196 a.a. Molecular weight: 21494.74 Da Isoelectric Point: 5.7110
>NTDB_id=880122 RJW56_RS07825 WP_002937303.1 1577740..1578330(-) (clpP) [Streptococcus suis strain 1522228]
MIPVVIEQTSRGERSYDIYSRLLKDRIIMLTGPVEDNMANSIIAQLLFLDAQDPTKDIYLYVNTPGGSVSAGLAIVDTMN
FIKADVQTIVMGTAASMGTIIASSGAKGKRFMLPNAEYMIHQPMGGTGGGTQQTDMAIAAEHLLKTRNKLEKILADNSGK
TVKQIHKDAERDYWMSAEETLAYGFIDQIMDNTKVK
MIPVVIEQTSRGERSYDIYSRLLKDRIIMLTGPVEDNMANSIIAQLLFLDAQDPTKDIYLYVNTPGGSVSAGLAIVDTMN
FIKADVQTIVMGTAASMGTIIASSGAKGKRFMLPNAEYMIHQPMGGTGGGTQQTDMAIAAEHLLKTRNKLEKILADNSGK
TVKQIHKDAERDYWMSAEETLAYGFIDQIMDNTKVK
Nucleotide
Download Length: 591 bp
>NTDB_id=880122 RJW56_RS07825 WP_002937303.1 1577740..1578330(-) (clpP) [Streptococcus suis strain 1522228]
ATGATTCCAGTAGTTATTGAACAAACTAGCCGTGGTGAGCGTTCTTATGATATTTACTCACGCCTTTTGAAAGACCGCAT
TATCATGTTGACAGGACCAGTTGAGGACAACATGGCAAACTCTATCATTGCACAATTGCTTTTCCTTGATGCCCAAGACC
CTACAAAGGATATTTACCTCTATGTTAATACGCCAGGAGGATCGGTGTCAGCAGGTCTTGCCATTGTAGACACGATGAAT
TTCATTAAAGCTGATGTTCAAACCATCGTTATGGGAACAGCTGCGAGCATGGGAACCATCATTGCATCAAGCGGTGCCAA
GGGCAAACGTTTCATGTTGCCAAATGCAGAGTACATGATTCACCAGCCAATGGGTGGAACTGGTGGTGGTACTCAGCAAA
CAGATATGGCTATTGCTGCAGAACACCTATTAAAAACACGTAATAAGCTAGAAAAAATCTTGGCAGACAACTCAGGTAAG
ACAGTCAAGCAAATCCACAAGGATGCAGAACGTGATTACTGGATGTCAGCTGAAGAAACCTTGGCTTATGGATTTATTGA
CCAGATTATGGACAATACAAAAGTCAAATAA
ATGATTCCAGTAGTTATTGAACAAACTAGCCGTGGTGAGCGTTCTTATGATATTTACTCACGCCTTTTGAAAGACCGCAT
TATCATGTTGACAGGACCAGTTGAGGACAACATGGCAAACTCTATCATTGCACAATTGCTTTTCCTTGATGCCCAAGACC
CTACAAAGGATATTTACCTCTATGTTAATACGCCAGGAGGATCGGTGTCAGCAGGTCTTGCCATTGTAGACACGATGAAT
TTCATTAAAGCTGATGTTCAAACCATCGTTATGGGAACAGCTGCGAGCATGGGAACCATCATTGCATCAAGCGGTGCCAA
GGGCAAACGTTTCATGTTGCCAAATGCAGAGTACATGATTCACCAGCCAATGGGTGGAACTGGTGGTGGTACTCAGCAAA
CAGATATGGCTATTGCTGCAGAACACCTATTAAAAACACGTAATAAGCTAGAAAAAATCTTGGCAGACAACTCAGGTAAG
ACAGTCAAGCAAATCCACAAGGATGCAGAACGTGATTACTGGATGTCAGCTGAAGAAACCTTGGCTTATGGATTTATTGA
CCAGATTATGGACAATACAAAAGTCAAATAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| clpP | Streptococcus pyogenes JRS4 |
92.347 |
100 |
0.923 |
| clpP | Streptococcus pyogenes MGAS315 |
92.347 |
100 |
0.923 |
| clpP | Streptococcus mutans UA159 |
90.306 |
100 |
0.903 |
| clpP | Streptococcus pneumoniae R6 |
88.776 |
100 |
0.888 |
| clpP | Streptococcus pneumoniae Rx1 |
88.776 |
100 |
0.888 |
| clpP | Streptococcus pneumoniae D39 |
88.776 |
100 |
0.888 |
| clpP | Streptococcus pneumoniae TIGR4 |
88.776 |
100 |
0.888 |
| clpP | Streptococcus thermophilus LMG 18311 |
88.776 |
100 |
0.888 |
| clpP | Streptococcus thermophilus LMD-9 |
88.776 |
100 |
0.888 |
| clpP | Lactococcus lactis subsp. lactis strain DGCC12653 |
84.184 |
100 |
0.842 |
| clpP | Lactococcus lactis subsp. cremoris KW2 |
83.673 |
100 |
0.837 |
| clpP | Bacillus subtilis subsp. subtilis str. 168 |
58.163 |
100 |
0.582 |
| clpP | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
58.549 |
98.469 |
0.577 |