Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   OCX48_RS10520 Genome accession   NZ_AP024736
Coordinates   2107057..2107527 (-) Length   156 a.a.
NCBI ID   WP_000934765.1    Uniprot ID   -
Organism   Staphylococcus aureus strain 59709     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2077553..2133041 2107057..2107527 within 0


Gene organization within MGE regions


Location: 2077553..2133041
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OCX48_RS10325 scn 2077553..2077903 (-) 351 WP_000702263.1 complement inhibitor SCIN-A -
  OCX48_RS10330 - 2078415..2078753 (-) 339 Protein_2002 SH3 domain-containing protein -
  OCX48_RS10335 sak 2079401..2079892 (-) 492 WP_000920038.1 staphylokinase -
  OCX48_RS10340 - 2080083..2080838 (-) 756 WP_000861038.1 CHAP domain-containing protein -
  OCX48_RS10345 - 2080850..2081104 (-) 255 WP_000611512.1 phage holin -
  OCX48_RS10350 - 2081152..2081259 (+) 108 WP_031762631.1 hypothetical protein -
  OCX48_RS10355 pepG1 2081312..2081446 (-) 135 WP_000226108.1 type I toxin-antitoxin system toxin PepG1 -
  OCX48_RS10360 sea 2081597..2082370 (-) 774 WP_000750412.1 staphylococcal enterotoxin type A -
  OCX48_RS10365 - 2082743..2083117 (-) 375 WP_000340977.1 hypothetical protein -
  OCX48_RS10370 - 2083173..2083460 (-) 288 WP_001262621.1 hypothetical protein -
  OCX48_RS10375 - 2083506..2083658 (-) 153 WP_001000058.1 hypothetical protein -
  OCX48_RS10380 - 2083651..2087433 (-) 3783 WP_117219101.1 phage tail spike protein -
  OCX48_RS10385 - 2087449..2088939 (-) 1491 WP_001154317.1 phage distal tail protein -
  OCX48_RS10390 - 2088939..2093588 (-) 4650 WP_001133533.1 phage tail tape measure protein -
  OCX48_RS10395 gpGT 2093644..2093766 (-) 123 WP_000570353.1 phage tail assembly chaperone GT -
  OCX48_RS10400 gpG 2093826..2094272 (-) 447 WP_000442601.1 phage tail assembly chaperone G -
  OCX48_RS10405 - 2094337..2095290 (-) 954 WP_000570652.1 major tail protein -
  OCX48_RS10410 - 2095291..2095671 (-) 381 WP_000611454.1 hypothetical protein -
  OCX48_RS10415 - 2095668..2096045 (-) 378 WP_000501244.1 HK97-gp10 family putative phage morphogenesis protein -
  OCX48_RS10420 - 2096045..2096380 (-) 336 WP_000975314.1 head-tail adaptor protein -
  OCX48_RS10425 - 2096367..2096699 (-) 333 WP_001177483.1 head-tail connector protein -
  OCX48_RS10430 - 2096708..2096866 (-) 159 WP_001252099.1 hypothetical protein -
  OCX48_RS10435 - 2096902..2098149 (-) 1248 WP_000849950.1 phage major capsid protein -
  OCX48_RS10440 - 2098237..2098821 (-) 585 WP_000032525.1 HK97 family phage prohead protease -
  OCX48_RS10445 - 2098814..2100064 (-) 1251 WP_000511067.1 phage portal protein -
  OCX48_RS10450 - 2100070..2100270 (-) 201 WP_000365299.1 hypothetical protein -
  OCX48_RS10455 - 2100284..2101978 (-) 1695 WP_000133304.1 terminase large subunit -
  OCX48_RS10460 - 2101981..2102448 (-) 468 WP_000919026.1 phage terminase small subunit P27 family -
  OCX48_RS10465 - 2102577..2102921 (-) 345 WP_000817289.1 HNH endonuclease -
  OCX48_RS10470 - 2102937..2103389 (-) 453 WP_000406191.1 nucleoside triphosphate pyrophosphohydrolase family protein -
  OCX48_RS10475 - 2103504..2103974 (-) 471 WP_000282755.1 hypothetical protein -
  OCX48_RS10480 - 2103997..2104197 (-) 201 WP_001570807.1 DUF1514 family protein -
  OCX48_RS10485 - 2104197..2104847 (-) 651 WP_001005262.1 hypothetical protein -
  OCX48_RS10490 rinB 2105006..2105155 (-) 150 WP_000595265.1 transcriptional activator RinB -
  OCX48_RS10500 - 2105199..2105483 (-) 285 Protein_2035 SA1788 family PVL leukocidin-associated protein -
  OCX48_RS10505 - 2105496..2105900 (-) 405 WP_000401978.1 RusA family crossover junction endodeoxyribonuclease -
  OCX48_RS10510 - 2105909..2106127 (-) 219 WP_000338527.1 hypothetical protein -
  OCX48_RS10515 - 2106134..2107027 (-) 894 WP_000148328.1 DnaD domain protein -
  OCX48_RS10520 ssbA 2107057..2107527 (-) 471 WP_000934765.1 single-stranded DNA-binding protein Machinery gene
  OCX48_RS10525 - 2107528..2108145 (-) 618 WP_072353921.1 MBL fold metallo-hydrolase -
  OCX48_RS10530 - 2108226..2109146 (-) 921 WP_000138475.1 recombinase RecT -
  OCX48_RS10535 - 2109148..2111103 (-) 1956 WP_064138715.1 AAA family ATPase -
  OCX48_RS10540 - 2111100..2111363 (-) 264 WP_001205732.1 hypothetical protein -
  OCX48_RS10545 - 2111372..2111632 (-) 261 WP_000291488.1 DUF1108 family protein -
  OCX48_RS10550 - 2111725..2111886 (-) 162 WP_000066020.1 DUF1270 domain-containing protein -
  OCX48_RS10555 - 2111883..2112203 (-) 321 WP_001120197.1 DUF771 domain-containing protein -
  OCX48_RS10560 - 2112262..2112894 (+) 633 WP_000275058.1 hypothetical protein -
  OCX48_RS10565 - 2112909..2113049 (-) 141 WP_000939496.1 hypothetical protein -
  OCX48_RS10570 - 2113080..2113277 (-) 198 WP_001148861.1 hypothetical protein -
  OCX48_RS10575 - 2113293..2114042 (-) 750 WP_001148337.1 phage antirepressor KilAC domain-containing protein -
  OCX48_RS10580 - 2114099..2114638 (+) 540 WP_000351243.1 hypothetical protein -
  OCX48_RS10585 - 2114662..2114922 (-) 261 WP_000435341.1 transcriptional regulator -
  OCX48_RS10590 - 2114940..2115164 (-) 225 WP_000338186.1 DUF739 family protein -
  OCX48_RS10595 - 2115323..2116093 (+) 771 WP_001208482.1 S24 family peptidase -
  OCX48_RS10600 seq 2116289..2117017 (+) 729 WP_001033320.1 staphylococcal enterotoxin type Q -
  OCX48_RS10605 sek 2117041..2117769 (+) 729 WP_000733771.1 staphylococcal enterotoxin type K -
  OCX48_RS10610 - 2117853..2118890 (+) 1038 WP_000857182.1 tyrosine-type recombinase/integrase -
  OCX48_RS10615 sph 2118947..2119771 (+) 825 Protein_2058 sphingomyelin phosphodiesterase -
  OCX48_RS10620 lukG 2120009..2121025 (-) 1017 WP_000595401.1 bi-component leukocidin LukGH subunit G -
  OCX48_RS10625 lukH 2121047..2122099 (-) 1053 WP_000791417.1 bi-component leukocidin LukGH subunit H -
  OCX48_RS10630 - 2122535..2123758 (+) 1224 WP_000206623.1 ArgE/DapE family deacylase -
  OCX48_RS10635 - 2124130..2124975 (-) 846 WP_000812008.1 class I SAM-dependent methyltransferase -
  OCX48_RS10640 - 2125037..2125948 (-) 912 WP_000825510.1 iron-hydroxamate ABC transporter substrate-binding protein -
  OCX48_RS10645 - 2126109..2127416 (+) 1308 WP_001045079.1 TrkH family potassium uptake protein -
  OCX48_RS10650 - 2128261..2128704 (-) 444 WP_000022887.1 GNAT family N-acetyltransferase -
  OCX48_RS10655 - 2128810..2129247 (-) 438 WP_072419900.1 hypothetical protein -
  OCX48_RS10660 - 2129564..2130154 (-) 591 WP_001293059.1 terminase small subunit -
  OCX48_RS10665 - 2130151..2130363 (-) 213 WP_000128898.1 LuxR C-terminal-related transcriptional regulator -
  OCX48_RS10670 - 2130424..2130970 (+) 547 Protein_2069 site-specific integrase -
  OCX48_RS10675 groL 2131065..2132681 (-) 1617 WP_000240642.1 chaperonin GroEL -
  OCX48_RS10680 groES 2132757..2133041 (-) 285 WP_000917289.1 co-chaperone GroES -

Sequence

Protein


Download         Length: 156 a.a.        Molecular weight: 17673.54 Da        Isoelectric Point: 4.9627

>NTDB_id=88007 OCX48_RS10520 WP_000934765.1 2107057..2107527(-) (ssbA) [Staphylococcus aureus strain 59709]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNTDDNQQDLYQQQAQQTRGQSQYSNNKPVKDNPFANANCPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=88007 OCX48_RS10520 WP_000934765.1 2107057..2107527(-) (ssbA) [Staphylococcus aureus strain 59709]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTAAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CACAGATGATAATCAACAAGATTTATACCAACAACAAGCGCAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATTGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.932

100

0.635
  ssb Latilactobacillus sakei subsp. sakei 23K

51.765

100

0.564
  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404
  ssb Vibrio cholerae strain A1552

31.492

100

0.365
  ssb Neisseria meningitidis MC58

32.948

100

0.365
  ssb Neisseria gonorrhoeae MS11

32.948

100

0.365
  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365

Multiple sequence alignment