Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | RE424_RS10720 | Genome accession | NZ_CP134047 |
| Coordinates | 2120140..2120610 (-) | Length | 156 a.a. |
| NCBI ID | WP_000934764.1 | Uniprot ID | A0A9P4DKA4 |
| Organism | Staphylococcus aureus strain 21SAU_AGRO3 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2089699..2146666 | 2120140..2120610 | within | 0 |
Gene organization within MGE regions
Location: 2089699..2146666
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RE424_RS10500 | scn | 2089699..2090049 (-) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| RE424_RS10505 | - | 2090734..2091183 (+) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| RE424_RS10510 | - | 2091278..2091616 (-) | 339 | Protein_2028 | SH3 domain-containing protein | - |
| RE424_RS10515 | sak | 2092263..2092754 (-) | 492 | WP_000919350.1 | staphylokinase | - |
| RE424_RS10520 | - | 2092945..2093700 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| RE424_RS10525 | - | 2093712..2093966 (-) | 255 | WP_000611512.1 | phage holin | - |
| RE424_RS10530 | - | 2094018..2094125 (+) | 108 | WP_001791821.1 | hypothetical protein | - |
| RE424_RS10535 | pepG1 | 2094178..2094312 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| RE424_RS10540 | sea | 2094463..2095236 (-) | 774 | WP_000750406.1 | staphylococcal enterotoxin type A | - |
| RE424_RS10545 | - | 2095657..2096031 (-) | 375 | WP_000340977.1 | hypothetical protein | - |
| RE424_RS10550 | - | 2096087..2096374 (-) | 288 | WP_001040259.1 | hypothetical protein | - |
| RE424_RS10555 | - | 2096421..2096573 (-) | 153 | WP_001153681.1 | hypothetical protein | - |
| RE424_RS10560 | - | 2096563..2100348 (-) | 3786 | WP_103254132.1 | phage tail spike protein | - |
| RE424_RS10565 | - | 2100364..2101848 (-) | 1485 | WP_000567413.1 | phage distal tail protein | - |
| RE424_RS10570 | - | 2101845..2106374 (-) | 4530 | WP_103254131.1 | phage tail tape measure protein | - |
| RE424_RS10575 | gpGT | 2106431..2106568 (-) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| RE424_RS10580 | gpG | 2106619..2106969 (-) | 351 | WP_001096355.1 | phage tail assembly chaperone G | - |
| RE424_RS10585 | - | 2107019..2107249 (-) | 231 | Protein_2043 | Ig-like domain-containing protein | - |
| RE424_RS10590 | - | 2107285..2107929 (-) | 645 | WP_000268735.1 | major tail protein | - |
| RE424_RS10595 | - | 2107930..2108337 (-) | 408 | WP_000565498.1 | hypothetical protein | - |
| RE424_RS10600 | - | 2108334..2108738 (-) | 405 | WP_000114226.1 | HK97 gp10 family phage protein | - |
| RE424_RS10605 | - | 2108735..2109097 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| RE424_RS10610 | - | 2109081..2109365 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| RE424_RS10615 | - | 2109355..2109639 (-) | 285 | WP_000238236.1 | hypothetical protein | - |
| RE424_RS10620 | - | 2109659..2110804 (-) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| RE424_RS10625 | - | 2110828..2111565 (-) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| RE424_RS10630 | - | 2111549..2112736 (-) | 1188 | WP_000025274.1 | phage portal protein | - |
| RE424_RS10635 | - | 2112752..2114413 (-) | 1662 | WP_310790808.1 | terminase large subunit | - |
| RE424_RS10640 | - | 2114410..2114754 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| RE424_RS10645 | - | 2114884..2115183 (-) | 300 | WP_000988336.1 | HNH endonuclease | - |
| RE424_RS10650 | - | 2115415..2115831 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| RE424_RS10655 | - | 2115859..2116059 (-) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| RE424_RS10660 | rinB | 2116059..2116208 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| RE424_RS10665 | - | 2116205..2116591 (-) | 387 | WP_000592207.1 | hypothetical protein | - |
| RE424_RS10670 | - | 2116588..2116794 (-) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| RE424_RS10675 | - | 2116831..2117373 (-) | 543 | WP_000185660.1 | dUTP diphosphatase | - |
| RE424_RS10680 | - | 2117366..2117548 (-) | 183 | WP_000028422.1 | hypothetical protein | - |
| RE424_RS10685 | - | 2117538..2117789 (-) | 252 | WP_001065091.1 | DUF1024 family protein | - |
| RE424_RS10690 | - | 2117782..2117949 (-) | 168 | WP_180991635.1 | hypothetical protein | - |
| RE424_RS10695 | - | 2117961..2118203 (-) | 243 | WP_000131366.1 | SAV1978 family virulence-associated passenger protein | - |
| RE424_RS10700 | - | 2118207..2118575 (-) | 369 | WP_000101274.1 | SA1788 family PVL leukocidin-associated protein | - |
| RE424_RS10705 | - | 2118588..2118992 (-) | 405 | WP_000401960.1 | RusA family crossover junction endodeoxyribonuclease | - |
| RE424_RS10710 | - | 2119001..2119219 (-) | 219 | WP_000338530.1 | hypothetical protein | - |
| RE424_RS10715 | - | 2119226..2120110 (-) | 885 | WP_000148316.1 | DnaD domain protein | - |
| RE424_RS10720 | ssbA | 2120140..2120610 (-) | 471 | WP_000934764.1 | single-stranded DNA-binding protein | Machinery gene |
| RE424_RS10725 | - | 2120611..2121228 (-) | 618 | WP_071621397.1 | MBL fold metallo-hydrolase | - |
| RE424_RS10730 | - | 2121309..2122229 (-) | 921 | WP_000138472.1 | recombinase RecT | - |
| RE424_RS10735 | - | 2122231..2124174 (-) | 1944 | Protein_2073 | AAA family ATPase | - |
| RE424_RS10740 | - | 2124183..2124446 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| RE424_RS10745 | - | 2124455..2124715 (-) | 261 | WP_103254134.1 | DUF1108 family protein | - |
| RE424_RS10750 | - | 2124696..2125022 (-) | 327 | WP_000165375.1 | DUF2482 family protein | - |
| RE424_RS10755 | - | 2125117..2125278 (-) | 162 | WP_000066017.1 | DUF1270 domain-containing protein | - |
| RE424_RS10760 | - | 2125275..2125595 (-) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| RE424_RS10765 | - | 2125654..2126286 (+) | 633 | WP_000275058.1 | hypothetical protein | - |
| RE424_RS10770 | - | 2126301..2126441 (-) | 141 | WP_000939496.1 | hypothetical protein | - |
| RE424_RS10775 | - | 2126472..2126669 (-) | 198 | WP_001148855.1 | hypothetical protein | - |
| RE424_RS14500 | - | 2126685..2127029 (-) | 345 | WP_078377265.1 | phage antirepressor KilAC domain-containing protein | - |
| RE424_RS14505 | - | 2127038..2127433 (-) | 396 | WP_169535470.1 | antA/AntB antirepressor family protein | - |
| RE424_RS10785 | - | 2127484..2127813 (+) | 330 | WP_000128907.1 | hypothetical protein | - |
| RE424_RS10790 | - | 2127802..2128017 (-) | 216 | WP_001025874.1 | MW1434 family type I TA system toxin | - |
| RE424_RS10795 | - | 2128014..2128295 (-) | 282 | WP_031929274.1 | helix-turn-helix transcriptional regulator | - |
| RE424_RS10800 | - | 2128292..2128465 (-) | 174 | WP_001801500.1 | hypothetical protein | - |
| RE424_RS10805 | - | 2128428..2129141 (+) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| RE424_RS10810 | - | 2129157..2130089 (+) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| RE424_RS10815 | - | 2130095..2130436 (+) | 342 | WP_000591749.1 | hypothetical protein | - |
| RE424_RS10820 | - | 2130640..2130822 (+) | 183 | WP_000705248.1 | hypothetical protein | - |
| RE424_RS10825 | - | 2130922..2131386 (+) | 465 | WP_000825947.1 | hypothetical protein | - |
| RE424_RS10830 | - | 2131445..2132482 (+) | 1038 | WP_310790809.1 | tyrosine-type recombinase/integrase | - |
| RE424_RS10835 | sph | 2132539..2133363 (+) | 825 | Protein_2094 | sphingomyelin phosphodiesterase | - |
| RE424_RS10840 | lukG | 2133601..2134617 (-) | 1017 | WP_000595401.1 | bi-component leukocidin LukGH subunit G | - |
| RE424_RS10845 | lukH | 2134639..2135691 (-) | 1053 | WP_000791417.1 | bi-component leukocidin LukGH subunit H | - |
| RE424_RS10850 | - | 2136127..2137350 (+) | 1224 | WP_000206623.1 | ArgE/DapE family deacylase | - |
| RE424_RS10855 | - | 2137722..2138567 (-) | 846 | WP_000812008.1 | class I SAM-dependent methyltransferase | - |
| RE424_RS10860 | - | 2138629..2139540 (-) | 912 | WP_000825510.1 | iron-hydroxamate ABC transporter substrate-binding protein | - |
| RE424_RS10865 | - | 2139701..2141008 (+) | 1308 | WP_001045079.1 | TrkH family potassium uptake protein | - |
| RE424_RS10870 | - | 2141862..2142305 (-) | 444 | WP_000022887.1 | GNAT family N-acetyltransferase | - |
| RE424_RS10875 | - | 2142411..2142848 (-) | 438 | WP_072419900.1 | hypothetical protein | - |
| RE424_RS10880 | - | 2143165..2143755 (-) | 591 | WP_023914874.1 | terminase small subunit | - |
| RE424_RS10885 | - | 2143752..2143964 (-) | 213 | WP_023914876.1 | LuxR C-terminal-related transcriptional regulator | - |
| RE424_RS10890 | - | 2144042..2144577 (+) | 536 | Protein_2105 | site-specific integrase | - |
| RE424_RS10895 | groL | 2144690..2146306 (-) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| RE424_RS10900 | groES | 2146382..2146666 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17627.49 Da Isoelectric Point: 5.2672
>NTDB_id=878345 RE424_RS10720 WP_000934764.1 2120140..2120610(-) (ssbA) [Staphylococcus aureus strain 21SAU_AGRO3]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=878345 RE424_RS10720 WP_000934764.1 2120140..2120610(-) (ssbA) [Staphylococcus aureus strain 21SAU_AGRO3]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.558 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Neisseria meningitidis MC58 |
33.526 |
100 |
0.372 |
| ssb | Neisseria gonorrhoeae MS11 |
33.526 |
100 |
0.372 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |
| ssb | Vibrio cholerae strain A1552 |
31.492 |
100 |
0.365 |