Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | RIM73_RS05010 | Genome accession | NZ_CP133956 |
| Coordinates | 996055..996243 (+) | Length | 62 a.a. |
| NCBI ID | WP_050317117.1 | Uniprot ID | - |
| Organism | Streptococcus equi subsp. equi strain HTP232 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 954870..1005796 | 996055..996243 | within | 0 |
Gene organization within MGE regions
Location: 954870..1005796
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RIM73_RS04725 (RIM73_04725) | - | 954870..955211 (-) | 342 | WP_012679448.1 | hypothetical protein | - |
| RIM73_RS04730 (RIM73_04730) | - | 955770..956858 (-) | 1089 | WP_317583080.1 | tyrosine-type recombinase/integrase | - |
| RIM73_RS04735 (RIM73_04735) | - | 956980..957285 (-) | 306 | WP_050322571.1 | hypothetical protein | - |
| RIM73_RS04740 (RIM73_04740) | - | 957295..958083 (-) | 789 | WP_317583081.1 | helix-turn-helix transcriptional regulator | - |
| RIM73_RS04745 (RIM73_04745) | - | 958368..959051 (-) | 684 | WP_043052997.1 | DUF4145 domain-containing protein | - |
| RIM73_RS04750 (RIM73_04750) | - | 959108..959338 (+) | 231 | WP_003056175.1 | helix-turn-helix transcriptional regulator | - |
| RIM73_RS04755 (RIM73_04755) | - | 959477..959659 (-) | 183 | WP_011889039.1 | hypothetical protein | - |
| RIM73_RS04760 (RIM73_04760) | - | 959766..960056 (+) | 291 | WP_317583082.1 | MerR family transcriptional regulator | - |
| RIM73_RS04765 (RIM73_04765) | - | 960058..960201 (+) | 144 | WP_317583083.1 | hypothetical protein | - |
| RIM73_RS04770 (RIM73_04770) | - | 960182..960358 (+) | 177 | WP_317583084.1 | hypothetical protein | - |
| RIM73_RS04775 (RIM73_04775) | - | 960360..960602 (+) | 243 | WP_317583085.1 | hypothetical protein | - |
| RIM73_RS04780 (RIM73_04780) | - | 960589..961872 (+) | 1284 | WP_317583086.1 | AAA family ATPase | - |
| RIM73_RS04785 (RIM73_04785) | - | 961888..962967 (+) | 1080 | WP_317583087.1 | ATP-binding protein | - |
| RIM73_RS04790 (RIM73_04790) | - | 963007..963429 (+) | 423 | WP_317583088.1 | hypothetical protein | - |
| RIM73_RS04795 (RIM73_04795) | - | 963431..964165 (+) | 735 | WP_050316125.1 | hypothetical protein | - |
| RIM73_RS04800 (RIM73_04800) | - | 964186..964788 (+) | 603 | WP_050316124.1 | hypothetical protein | - |
| RIM73_RS04805 (RIM73_04805) | - | 964788..966371 (+) | 1584 | WP_317583089.1 | DEAD/DEAH box helicase family protein | - |
| RIM73_RS04810 (RIM73_04810) | - | 966384..968657 (+) | 2274 | WP_050316122.1 | AAA family ATPase | - |
| RIM73_RS04815 (RIM73_04815) | - | 968935..969153 (+) | 219 | WP_050315884.1 | hypothetical protein | - |
| RIM73_RS04820 (RIM73_04820) | - | 969146..969541 (+) | 396 | WP_050315883.1 | RusA family crossover junction endodeoxyribonuclease | - |
| RIM73_RS04825 (RIM73_04825) | - | 969538..969762 (+) | 225 | WP_050315882.1 | hypothetical protein | - |
| RIM73_RS04830 (RIM73_04830) | - | 969765..969950 (+) | 186 | WP_050316121.1 | hypothetical protein | - |
| RIM73_RS04835 (RIM73_04835) | - | 969947..970069 (+) | 123 | WP_317583090.1 | hypothetical protein | - |
| RIM73_RS04840 (RIM73_04840) | - | 970062..970289 (+) | 228 | WP_317583091.1 | hypothetical protein | - |
| RIM73_RS04845 (RIM73_04845) | - | 970293..970634 (+) | 342 | WP_317583092.1 | hypothetical protein | - |
| RIM73_RS04850 (RIM73_04850) | - | 970636..971388 (+) | 753 | WP_317583093.1 | DNA methyltransferase | - |
| RIM73_RS04855 (RIM73_04855) | - | 971385..971600 (+) | 216 | WP_317583094.1 | hypothetical protein | - |
| RIM73_RS04860 (RIM73_04860) | - | 971674..972111 (+) | 438 | WP_317583095.1 | DUF1492 domain-containing protein | - |
| RIM73_RS04865 (RIM73_04865) | - | 972696..973073 (-) | 378 | WP_012679314.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| RIM73_RS04870 (RIM73_04870) | - | 973125..973310 (-) | 186 | WP_012679315.1 | type II toxin-antitoxin system HicA family toxin | - |
| RIM73_RS04875 (RIM73_04875) | - | 973426..973761 (+) | 336 | WP_012679316.1 | HNH endonuclease | - |
| RIM73_RS04880 (RIM73_04880) | - | 973924..974391 (+) | 468 | WP_126405152.1 | phage terminase small subunit P27 family | - |
| RIM73_RS04885 (RIM73_04885) | - | 974406..976160 (+) | 1755 | WP_050319690.1 | terminase large subunit | - |
| RIM73_RS04890 (RIM73_04890) | - | 976157..976327 (+) | 171 | WP_012679318.1 | hypothetical protein | - |
| RIM73_RS04895 (RIM73_04895) | - | 976320..976586 (+) | 267 | WP_012679319.1 | hypothetical protein | - |
| RIM73_RS04900 (RIM73_04900) | - | 976620..977840 (+) | 1221 | WP_012679320.1 | phage portal protein | - |
| RIM73_RS04905 (RIM73_04905) | - | 977818..978483 (+) | 666 | WP_012679321.1 | head maturation protease, ClpP-related | - |
| RIM73_RS04910 (RIM73_04910) | - | 978508..979695 (+) | 1188 | WP_317583096.1 | phage major capsid protein | - |
| RIM73_RS04915 (RIM73_04915) | - | 979709..979837 (+) | 129 | WP_012679323.1 | hypothetical protein | - |
| RIM73_RS04920 (RIM73_04920) | - | 979840..980142 (+) | 303 | WP_012679324.1 | head-tail connector protein | - |
| RIM73_RS04925 (RIM73_04925) | - | 980139..980486 (+) | 348 | WP_012679325.1 | phage head closure protein | - |
| RIM73_RS04930 (RIM73_04930) | - | 980483..980860 (+) | 378 | WP_012679326.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| RIM73_RS04935 (RIM73_04935) | - | 980857..981282 (+) | 426 | WP_050315850.1 | hypothetical protein | - |
| RIM73_RS04940 (RIM73_04940) | - | 981298..981888 (+) | 591 | WP_317583097.1 | major tail protein | - |
| RIM73_RS04945 (RIM73_04945) | gpG | 981940..982266 (+) | 327 | WP_012679329.1 | phage tail assembly chaperone G | - |
| RIM73_RS04950 (RIM73_04950) | - | 982314..982463 (+) | 150 | WP_021299462.1 | hypothetical protein | - |
| RIM73_RS04955 (RIM73_04955) | - | 982476..986135 (+) | 3660 | WP_214494382.1 | phage tail tape measure protein | - |
| RIM73_RS04960 (RIM73_04960) | - | 986135..986842 (+) | 708 | WP_317583098.1 | distal tail protein Dit | - |
| RIM73_RS04965 (RIM73_04965) | - | 986839..988983 (+) | 2145 | WP_317583099.1 | phage tail spike protein | - |
| RIM73_RS04970 (RIM73_04970) | - | 988980..990092 (+) | 1113 | WP_317583100.1 | hyaluronoglucosaminidase | - |
| RIM73_RS04975 (RIM73_04975) | - | 990102..991985 (+) | 1884 | WP_317583101.1 | gp58-like family protein | - |
| RIM73_RS04980 (RIM73_04980) | - | 991994..992425 (+) | 432 | WP_317583102.1 | DUF1617 family protein | - |
| RIM73_RS04985 (RIM73_04985) | - | 992428..993039 (+) | 612 | WP_317583103.1 | DUF1366 domain-containing protein | - |
| RIM73_RS04990 (RIM73_04990) | - | 993051..993422 (+) | 372 | WP_012678881.1 | phage holin family protein | - |
| RIM73_RS04995 (RIM73_04995) | - | 993539..994750 (+) | 1212 | WP_317583104.1 | glucosaminidase domain-containing protein | - |
| RIM73_RS05000 (RIM73_05000) | - | 995131..995706 (+) | 576 | WP_012679345.1 | phospholipase A2 SlaA | - |
| RIM73_RS05010 (RIM73_05010) | prx | 996055..996243 (+) | 189 | WP_050317117.1 | Paratox | Regulator |
| RIM73_RS05020 (RIM73_05020) | - | 996836..997447 (+) | 612 | WP_012679449.1 | TVP38/TMEM64 family protein | - |
| RIM73_RS05025 (RIM73_05025) | - | 997494..998288 (-) | 795 | WP_012515506.1 | hypothetical protein | - |
| RIM73_RS05030 (RIM73_05030) | - | 998298..998996 (-) | 699 | WP_012515507.1 | ABC transporter ATP-binding protein | - |
| RIM73_RS05035 (RIM73_05035) | - | 998996..999367 (-) | 372 | WP_012679450.1 | GntR family transcriptional regulator | - |
| RIM73_RS05040 (RIM73_05040) | - | 999609..1002719 (+) | 3111 | WP_012679451.1 | DNA polymerase III subunit alpha | - |
| RIM73_RS05045 (RIM73_05045) | - | 1002883..1004604 (+) | 1722 | WP_317583045.1 | IS1634-like element ISSeq4 family transposase | - |
| RIM73_RS05050 (RIM73_05050) | pfkA | 1004783..1005796 (+) | 1014 | WP_012515510.1 | 6-phosphofructokinase | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7281.27 Da Isoelectric Point: 5.0079
>NTDB_id=877922 RIM73_RS05010 WP_050317117.1 996055..996243(+) (prx) [Streptococcus equi subsp. equi strain HTP232]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHESVRSWEVVTEERVEAVLKELHYIK
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHESVRSWEVVTEERVEAVLKELHYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=877922 RIM73_RS05010 WP_050317117.1 996055..996243(+) (prx) [Streptococcus equi subsp. equi strain HTP232]
GTGTTAACATACGACGAGTTTAAGCAGGCTATTGATCATGGTTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGTCTGTGAGATCGTGGGAGGTTGTGACTGAAGAAAGAGTAGAAGCAG
TACTAAAAGAATTACACTATATTAAATGA
GTGTTAACATACGACGAGTTTAAGCAGGCTATTGATCATGGTTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGTCTGTGAGATCGTGGGAGGTTGTGACTGAAGAAAGAGTAGAAGCAG
TACTAAAAGAATTACACTATATTAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
80.645 |
100 |
0.806 |
| prx | Streptococcus pyogenes MGAS315 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS8232 |
81.034 |
93.548 |
0.758 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
95.161 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
88.095 |
67.742 |
0.597 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
67.742 |
0.548 |