Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | RIM64_RS08165 | Genome accession | NZ_CP133951 |
| Coordinates | 1715634..1715813 (-) | Length | 59 a.a. |
| NCBI ID | WP_050319824.1 | Uniprot ID | - |
| Organism | Streptococcus equi subsp. zooepidemicus strain JMC111 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1714512..1757550 | 1715634..1715813 | within | 0 |
Gene organization within MGE regions
Location: 1714512..1757550
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RIM64_RS08160 (RIM64_08160) | - | 1714512..1715027 (+) | 516 | WP_021320424.1 | hypothetical protein | - |
| RIM64_RS08165 (RIM64_08165) | prx | 1715634..1715813 (-) | 180 | WP_050319824.1 | hypothetical protein | Regulator |
| RIM64_RS08170 (RIM64_08170) | - | 1716046..1717038 (+) | 993 | WP_015986728.1 | DNA/RNA non-specific endonuclease | - |
| RIM64_RS08175 (RIM64_08175) | - | 1717101..1717910 (-) | 810 | WP_015986727.1 | hypothetical protein | - |
| RIM64_RS08180 (RIM64_08180) | - | 1717901..1718422 (-) | 522 | WP_015986726.1 | Panacea domain-containing protein | - |
| RIM64_RS08185 (RIM64_08185) | - | 1718575..1719777 (-) | 1203 | WP_015986725.1 | glucosaminidase domain-containing protein | - |
| RIM64_RS08190 (RIM64_08190) | - | 1719893..1720120 (-) | 228 | WP_003058873.1 | phage holin | - |
| RIM64_RS08195 (RIM64_08195) | - | 1720117..1720392 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| RIM64_RS08200 (RIM64_08200) | - | 1720402..1721013 (-) | 612 | WP_050317156.1 | hypothetical protein | - |
| RIM64_RS08205 (RIM64_08205) | - | 1721016..1721447 (-) | 432 | WP_015986722.1 | DUF1617 family protein | - |
| RIM64_RS08210 (RIM64_08210) | - | 1721456..1723360 (-) | 1905 | WP_214494841.1 | gp58-like family protein | - |
| RIM64_RS08215 (RIM64_08215) | - | 1723379..1724479 (-) | 1101 | WP_015986720.1 | hyaluronidase | - |
| RIM64_RS08220 (RIM64_08220) | - | 1724479..1726461 (-) | 1983 | WP_015986719.1 | phage tail protein | - |
| RIM64_RS08225 (RIM64_08225) | - | 1726471..1727313 (-) | 843 | WP_015986718.1 | phage tail family protein | - |
| RIM64_RS08230 (RIM64_08230) | - | 1727325..1731482 (-) | 4158 | WP_015986717.1 | tape measure protein | - |
| RIM64_RS08235 (RIM64_08235) | - | 1731497..1731730 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| RIM64_RS08240 (RIM64_08240) | - | 1731805..1732260 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| RIM64_RS08245 (RIM64_08245) | - | 1732314..1732913 (-) | 600 | WP_002983441.1 | phage major tail protein, TP901-1 family | - |
| RIM64_RS08250 (RIM64_08250) | - | 1732925..1733284 (-) | 360 | WP_002983439.1 | hypothetical protein | - |
| RIM64_RS08255 (RIM64_08255) | - | 1733288..1733632 (-) | 345 | WP_050317072.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| RIM64_RS08260 (RIM64_08260) | - | 1733629..1733907 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| RIM64_RS08265 (RIM64_08265) | - | 1733918..1734274 (-) | 357 | WP_002983431.1 | phage head-tail connector protein | - |
| RIM64_RS08270 (RIM64_08270) | - | 1734286..1735173 (-) | 888 | WP_002983429.1 | hypothetical protein | - |
| RIM64_RS08275 (RIM64_08275) | - | 1735186..1735755 (-) | 570 | WP_002983425.1 | DUF4355 domain-containing protein | - |
| RIM64_RS08280 (RIM64_08280) | - | 1735911..1736177 (-) | 267 | WP_050317087.1 | hypothetical protein | - |
| RIM64_RS08285 (RIM64_08285) | - | 1736180..1736368 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| RIM64_RS08290 (RIM64_08290) | - | 1736399..1737844 (-) | 1446 | WP_050317145.1 | minor capsid protein | - |
| RIM64_RS08295 (RIM64_08295) | - | 1737804..1739336 (-) | 1533 | WP_023611655.1 | phage portal protein | - |
| RIM64_RS08300 (RIM64_08300) | - | 1739352..1740629 (-) | 1278 | WP_050318640.1 | PBSX family phage terminase large subunit | - |
| RIM64_RS08305 (RIM64_08305) | - | 1740619..1741071 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| RIM64_RS08310 (RIM64_08310) | - | 1741161..1741577 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| RIM64_RS08315 (RIM64_08315) | - | 1741780..1742049 (-) | 270 | WP_050317163.1 | hypothetical protein | - |
| RIM64_RS08320 (RIM64_08320) | - | 1742049..1742222 (-) | 174 | WP_015986713.1 | hypothetical protein | - |
| RIM64_RS08325 (RIM64_08325) | - | 1742219..1742386 (-) | 168 | WP_015986712.1 | hypothetical protein | - |
| RIM64_RS08330 (RIM64_08330) | - | 1742387..1743709 (-) | 1323 | WP_015986711.1 | SNF2-related protein | - |
| RIM64_RS08335 (RIM64_08335) | - | 1743706..1743981 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| RIM64_RS08340 (RIM64_08340) | - | 1744348..1746732 (-) | 2385 | WP_050317067.1 | phage/plasmid primase, P4 family | - |
| RIM64_RS08345 (RIM64_08345) | - | 1746737..1748659 (-) | 1923 | WP_015986708.1 | DNA polymerase | - |
| RIM64_RS08350 (RIM64_08350) | - | 1748702..1749265 (-) | 564 | WP_002983410.1 | DUF2815 family protein | - |
| RIM64_RS08355 (RIM64_08355) | - | 1749279..1750436 (-) | 1158 | WP_015986706.1 | DUF2800 domain-containing protein | - |
| RIM64_RS08360 (RIM64_08360) | - | 1750436..1750735 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| RIM64_RS08365 (RIM64_08365) | - | 1750823..1751026 (-) | 204 | WP_002983407.1 | hypothetical protein | - |
| RIM64_RS08370 (RIM64_08370) | - | 1751023..1751175 (-) | 153 | WP_002983406.1 | hypothetical protein | - |
| RIM64_RS08375 (RIM64_08375) | - | 1751172..1751555 (-) | 384 | WP_002983405.1 | hypothetical protein | - |
| RIM64_RS08380 (RIM64_08380) | - | 1751552..1751758 (-) | 207 | WP_050317062.1 | hypothetical protein | - |
| RIM64_RS08385 (RIM64_08385) | - | 1751751..1751921 (-) | 171 | WP_015986705.1 | hypothetical protein | - |
| RIM64_RS08390 (RIM64_08390) | - | 1751918..1752193 (-) | 276 | WP_015986704.1 | hypothetical protein | - |
| RIM64_RS08395 (RIM64_08395) | - | 1752259..1752459 (-) | 201 | WP_231146360.1 | hypothetical protein | - |
| RIM64_RS08400 (RIM64_08400) | - | 1752510..1752701 (-) | 192 | WP_001283052.1 | hypothetical protein | - |
| RIM64_RS08405 (RIM64_08405) | - | 1753457..1753816 (+) | 360 | WP_015986702.1 | helix-turn-helix domain-containing protein | - |
| RIM64_RS08410 (RIM64_08410) | - | 1753830..1754213 (+) | 384 | WP_015986701.1 | ImmA/IrrE family metallo-endopeptidase | - |
| RIM64_RS08415 (RIM64_08415) | - | 1754224..1754775 (+) | 552 | WP_015986700.1 | hypothetical protein | - |
| RIM64_RS08420 (RIM64_08420) | - | 1754894..1755973 (+) | 1080 | WP_015986699.1 | tyrosine-type recombinase/integrase | - |
| RIM64_RS08430 (RIM64_08430) | - | 1756294..1757550 (+) | 1257 | WP_231148149.1 | ISL3 family transposase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6931.74 Da Isoelectric Point: 3.8957
>NTDB_id=877724 RIM64_RS08165 WP_050319824.1 1715634..1715813(-) (prx) [Streptococcus equi subsp. zooepidemicus strain JMC111]
MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYVLPHEEVRSWEVSIEEIVEEVLRELE
MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYVLPHEEVRSWEVSIEEIVEEVLRELE
Nucleotide
Download Length: 180 bp
>NTDB_id=877724 RIM64_RS08165 WP_050319824.1 1715634..1715813(-) (prx) [Streptococcus equi subsp. zooepidemicus strain JMC111]
ATGCTAACATACGACGAATTTAAACAGGCAATTGATGACGGATATATCACAGGAGACACAGTAGCGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTATTGCCGCATGAGGAAGTGAGGTCGTGGGAGGTGTCAATAGAAGAAATAGTGGAAGAAG
TGCTGCGGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAACAGGCAATTGATGACGGATATATCACAGGAGACACAGTAGCGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTATTGCCGCATGAGGAAGTGAGGTCGTGGGAGGTGTCAATAGAAGAAATAGTGGAAGAAG
TGCTGCGGGAATTGGAGTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
79.661 |
100 |
0.797 |
| prx | Streptococcus pyogenes MGAS8232 |
79.31 |
98.305 |
0.78 |
| prx | Streptococcus pyogenes MGAS315 |
74.138 |
98.305 |
0.729 |
| prx | Streptococcus pyogenes MGAS315 |
90.476 |
71.186 |
0.644 |
| prx | Streptococcus pyogenes MGAS315 |
88.095 |
71.186 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
69.492 |
0.576 |