Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | RIM62_RS08170 | Genome accession | NZ_CP133950 |
| Coordinates | 1715647..1715826 (-) | Length | 59 a.a. |
| NCBI ID | WP_050319824.1 | Uniprot ID | - |
| Organism | Streptococcus equi subsp. zooepidemicus strain ZHZ211 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1714525..1757563 | 1715647..1715826 | within | 0 |
Gene organization within MGE regions
Location: 1714525..1757563
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RIM62_RS08165 (RIM62_08165) | - | 1714525..1715040 (+) | 516 | WP_021320424.1 | hypothetical protein | - |
| RIM62_RS08170 (RIM62_08170) | prx | 1715647..1715826 (-) | 180 | WP_050319824.1 | hypothetical protein | Regulator |
| RIM62_RS08175 (RIM62_08175) | - | 1716059..1717051 (+) | 993 | WP_015986728.1 | DNA/RNA non-specific endonuclease | - |
| RIM62_RS08180 (RIM62_08180) | - | 1717114..1717923 (-) | 810 | WP_015986727.1 | hypothetical protein | - |
| RIM62_RS08185 (RIM62_08185) | - | 1717914..1718435 (-) | 522 | WP_015986726.1 | Panacea domain-containing protein | - |
| RIM62_RS08190 (RIM62_08190) | - | 1718588..1719790 (-) | 1203 | WP_015986725.1 | glucosaminidase domain-containing protein | - |
| RIM62_RS08195 (RIM62_08195) | - | 1719906..1720133 (-) | 228 | WP_003058873.1 | phage holin | - |
| RIM62_RS08200 (RIM62_08200) | - | 1720130..1720405 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| RIM62_RS08205 (RIM62_08205) | - | 1720415..1721026 (-) | 612 | WP_050317156.1 | hypothetical protein | - |
| RIM62_RS08210 (RIM62_08210) | - | 1721029..1721460 (-) | 432 | WP_015986722.1 | DUF1617 family protein | - |
| RIM62_RS08215 (RIM62_08215) | - | 1721469..1723373 (-) | 1905 | WP_214494841.1 | gp58-like family protein | - |
| RIM62_RS08220 (RIM62_08220) | - | 1723392..1724492 (-) | 1101 | WP_015986720.1 | hyaluronidase | - |
| RIM62_RS08225 (RIM62_08225) | - | 1724492..1726474 (-) | 1983 | WP_015986719.1 | phage tail protein | - |
| RIM62_RS08230 (RIM62_08230) | - | 1726484..1727326 (-) | 843 | WP_015986718.1 | phage tail family protein | - |
| RIM62_RS08235 (RIM62_08235) | - | 1727338..1731495 (-) | 4158 | WP_015986717.1 | tape measure protein | - |
| RIM62_RS08240 (RIM62_08240) | - | 1731510..1731743 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| RIM62_RS08245 (RIM62_08245) | - | 1731818..1732273 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| RIM62_RS08250 (RIM62_08250) | - | 1732327..1732926 (-) | 600 | WP_002983441.1 | phage major tail protein, TP901-1 family | - |
| RIM62_RS08255 (RIM62_08255) | - | 1732938..1733297 (-) | 360 | WP_002983439.1 | hypothetical protein | - |
| RIM62_RS08260 (RIM62_08260) | - | 1733301..1733645 (-) | 345 | WP_050317072.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| RIM62_RS08265 (RIM62_08265) | - | 1733642..1733920 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| RIM62_RS08270 (RIM62_08270) | - | 1733931..1734287 (-) | 357 | WP_002983431.1 | phage head-tail connector protein | - |
| RIM62_RS08275 (RIM62_08275) | - | 1734299..1735186 (-) | 888 | WP_002983429.1 | hypothetical protein | - |
| RIM62_RS08280 (RIM62_08280) | - | 1735199..1735768 (-) | 570 | WP_002983425.1 | DUF4355 domain-containing protein | - |
| RIM62_RS08285 (RIM62_08285) | - | 1735924..1736190 (-) | 267 | WP_050317087.1 | hypothetical protein | - |
| RIM62_RS08290 (RIM62_08290) | - | 1736193..1736381 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| RIM62_RS08295 (RIM62_08295) | - | 1736412..1737857 (-) | 1446 | WP_050317145.1 | minor capsid protein | - |
| RIM62_RS08300 (RIM62_08300) | - | 1737817..1739349 (-) | 1533 | WP_023611655.1 | phage portal protein | - |
| RIM62_RS08305 (RIM62_08305) | - | 1739365..1740642 (-) | 1278 | WP_050318640.1 | PBSX family phage terminase large subunit | - |
| RIM62_RS08310 (RIM62_08310) | - | 1740632..1741084 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| RIM62_RS08315 (RIM62_08315) | - | 1741174..1741590 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| RIM62_RS08320 (RIM62_08320) | - | 1741793..1742062 (-) | 270 | WP_050317163.1 | hypothetical protein | - |
| RIM62_RS08325 (RIM62_08325) | - | 1742062..1742235 (-) | 174 | WP_015986713.1 | hypothetical protein | - |
| RIM62_RS08330 (RIM62_08330) | - | 1742232..1742399 (-) | 168 | WP_015986712.1 | hypothetical protein | - |
| RIM62_RS08335 (RIM62_08335) | - | 1742400..1743722 (-) | 1323 | WP_015986711.1 | SNF2-related protein | - |
| RIM62_RS08340 (RIM62_08340) | - | 1743719..1743994 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| RIM62_RS08345 (RIM62_08345) | - | 1744361..1746745 (-) | 2385 | WP_050317067.1 | phage/plasmid primase, P4 family | - |
| RIM62_RS08350 (RIM62_08350) | - | 1746750..1748672 (-) | 1923 | WP_015986708.1 | DNA polymerase | - |
| RIM62_RS08355 (RIM62_08355) | - | 1748715..1749278 (-) | 564 | WP_002983410.1 | DUF2815 family protein | - |
| RIM62_RS08360 (RIM62_08360) | - | 1749292..1750449 (-) | 1158 | WP_015986706.1 | DUF2800 domain-containing protein | - |
| RIM62_RS08365 (RIM62_08365) | - | 1750449..1750748 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| RIM62_RS08370 (RIM62_08370) | - | 1750836..1751039 (-) | 204 | WP_002983407.1 | hypothetical protein | - |
| RIM62_RS08375 (RIM62_08375) | - | 1751036..1751188 (-) | 153 | WP_002983406.1 | hypothetical protein | - |
| RIM62_RS08380 (RIM62_08380) | - | 1751185..1751568 (-) | 384 | WP_002983405.1 | hypothetical protein | - |
| RIM62_RS08385 (RIM62_08385) | - | 1751565..1751771 (-) | 207 | WP_050317062.1 | hypothetical protein | - |
| RIM62_RS08390 (RIM62_08390) | - | 1751764..1751934 (-) | 171 | WP_015986705.1 | hypothetical protein | - |
| RIM62_RS08395 (RIM62_08395) | - | 1751931..1752206 (-) | 276 | WP_015986704.1 | hypothetical protein | - |
| RIM62_RS08400 (RIM62_08400) | - | 1752272..1752472 (-) | 201 | WP_231146360.1 | hypothetical protein | - |
| RIM62_RS08405 (RIM62_08405) | - | 1752523..1752714 (-) | 192 | WP_001283052.1 | hypothetical protein | - |
| RIM62_RS08410 (RIM62_08410) | - | 1753470..1753829 (+) | 360 | WP_015986702.1 | helix-turn-helix domain-containing protein | - |
| RIM62_RS08415 (RIM62_08415) | - | 1753843..1754226 (+) | 384 | WP_015986701.1 | ImmA/IrrE family metallo-endopeptidase | - |
| RIM62_RS08420 (RIM62_08420) | - | 1754237..1754788 (+) | 552 | WP_015986700.1 | hypothetical protein | - |
| RIM62_RS08425 (RIM62_08425) | - | 1754907..1755986 (+) | 1080 | WP_015986699.1 | tyrosine-type recombinase/integrase | - |
| RIM62_RS08435 (RIM62_08435) | - | 1756307..1757563 (+) | 1257 | WP_231148149.1 | ISL3 family transposase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6931.74 Da Isoelectric Point: 3.8957
>NTDB_id=877662 RIM62_RS08170 WP_050319824.1 1715647..1715826(-) (prx) [Streptococcus equi subsp. zooepidemicus strain ZHZ211]
MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYVLPHEEVRSWEVSIEEIVEEVLRELE
MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYVLPHEEVRSWEVSIEEIVEEVLRELE
Nucleotide
Download Length: 180 bp
>NTDB_id=877662 RIM62_RS08170 WP_050319824.1 1715647..1715826(-) (prx) [Streptococcus equi subsp. zooepidemicus strain ZHZ211]
ATGCTAACATACGACGAATTTAAACAGGCAATTGATGACGGATATATCACAGGAGACACAGTAGCGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTATTGCCGCATGAGGAAGTGAGGTCGTGGGAGGTGTCAATAGAAGAAATAGTGGAAGAAG
TGCTGCGGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAACAGGCAATTGATGACGGATATATCACAGGAGACACAGTAGCGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTATTGCCGCATGAGGAAGTGAGGTCGTGGGAGGTGTCAATAGAAGAAATAGTGGAAGAAG
TGCTGCGGGAATTGGAGTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
79.661 |
100 |
0.797 |
| prx | Streptococcus pyogenes MGAS8232 |
79.31 |
98.305 |
0.78 |
| prx | Streptococcus pyogenes MGAS315 |
74.138 |
98.305 |
0.729 |
| prx | Streptococcus pyogenes MGAS315 |
90.476 |
71.186 |
0.644 |
| prx | Streptococcus pyogenes MGAS315 |
88.095 |
71.186 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
69.492 |
0.576 |