NTDB

Overview

Name	clpP	Type	Regulator
Locus tag	RE735_RS03575	Genome accession	NZ_CP133585
Coordinates	702358..702954 (-)	Length	198 a.a.
NCBI ID	WP_024719872.1	Uniprot ID	A0A2G8ISB7
Organism	Bacillus aerius strain NEB1378
Function	degradation of ComK; degradation of DegU (predicted from homology) Competence regulation

Genomic Context

Location: 697358..707954

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
RE735_RS03550 (RE735_03550)	-	697435..698412 (-)	978	WP_309174611.1	D-glycerate dehydrogenase	-
RE735_RS03555 (RE735_03555)	-	698976..699557 (+)	582	WP_309174612.1	carbonic anhydrase	-
RE735_RS03560 (RE735_03560)	-	699595..701217 (+)	1623	WP_309174613.1	SulP family inorganic anion transporter	-
RE735_RS03565 (RE735_03565)	-	701246..701587 (-)	342	WP_284725741.1	MazG-like family protein	-
RE735_RS03570 (RE735_03570)	-	701724..702302 (+)	579	WP_024719873.1	TIGR00730 family Rossman fold protein	-
RE735_RS03575 (RE735_03575)	clpP	702358..702954 (-)	597	WP_024719872.1	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	Regulator
RE735_RS03585 (RE735_03585)	-	703578..703829 (+)	252	WP_309174614.1	hypothetical protein	-
RE735_RS03590 (RE735_03590)	nikA	703937..705568 (+)	1632	WP_309174615.1	nickel ABC transporter substrate-binding protein	-
RE735_RS03595 (RE735_03595)	opp1B	705584..706513 (+)	930	WP_309174616.1	nickel/cobalt ABC transporter permease	-
RE735_RS03600 (RE735_03600)	opp1C	706520..707407 (+)	888	WP_309174617.1	nickel/cobalt ABC transporter permease	-

Sequence

Protein

Download Length: 198 a.a. Molecular weight: 21832.00 Da Isoelectric Point: 4.6905

                                >NTDB_id=875093 RE735_RS03575 WP_024719872.1 702358..702954(-) (clpP) [Bacillus aerius strain NEB1378]

MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLEAEDPEKDISIYINSPGGSITAGMAIYDT

MQFIKPKVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILSLRDKLNQVLAERTGQ

PIEVIERDTDRDNFKTAEEALQYGLIDKVLTRNSEEQK

Nucleotide

Download Length: 597 bp

                                >NTDB_id=875093 RE735_RS03575 WP_024719872.1 702358..702954(-) (clpP) [Bacillus aerius strain NEB1378]

ATGAATTTAATACCTACAGTCATTGAGCAAACAAATCGTGGGGAAAGAGCTTACGACATTTATTCTCGTCTTTTAAAAGA

CCGTATTATCATGCTTGGTTCTGCGATCGATGACAATGTTGCCAACTCCATCGTATCACAGCTTCTCTTCTTAGAAGCCG

AGGATCCAGAAAAAGATATCTCTATCTACATTAACAGCCCTGGCGGTTCGATCACAGCTGGTATGGCCATTTATGATACG

ATGCAATTTATTAAACCAAAGGTATCAACTATTTGTATTGGTATGGCTGCATCTATGGGTGCGTTCCTGCTTGCTGCTGG

TGAAAAAGGTAAGCGTTATGCCCTTCCAAATAGTGAAGTGATGATTCACCAACCACTAGGTGGTGCGCAAGGTCAAGCAA

CAGAAATTGAAATTGCGGCAAAACGAATCCTTTCTTTACGCGATAAACTGAACCAAGTACTTGCTGAACGTACTGGTCAG

CCAATTGAAGTCATTGAGCGCGATACAGATCGTGACAACTTCAAAACAGCGGAAGAAGCACTTCAATACGGACTCATTGA

CAAAGTCTTGACCCGTAATTCAGAAGAACAAAAATAA

Domains

Predicted by InterproScan.

Clp protease (CLP_protease)

(13-192)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A2G8ISB7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
clpP	Bacillus subtilis subsp. subtilis str. 168	92.929	100	0.929
clpP	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	67.539	96.465	0.652
clpP	Streptococcus thermophilus LMG 18311	58.549	97.475	0.571
clpP	Streptococcus thermophilus LMD-9	58.549	97.475	0.571
clpP	Lactococcus lactis subsp. cremoris KW2	56.701	97.98	0.556
clpP	Streptococcus pneumoniae Rx1	56.186	97.98	0.551
clpP	Streptococcus pneumoniae D39	56.186	97.98	0.551
clpP	Streptococcus pneumoniae R6	56.186	97.98	0.551
clpP	Streptococcus pneumoniae TIGR4	56.186	97.98	0.551
clpP	Streptococcus pyogenes JRS4	55.44	97.475	0.54
clpP	Streptococcus pyogenes MGAS315	55.44	97.475	0.54
clpP	Streptococcus mutans UA159	54.639	97.98	0.535
clpP	Lactococcus lactis subsp. lactis strain DGCC12653	54.639	97.98	0.535

Detailed information NTG0875093