Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | RA106_RS03935 | Genome accession | NZ_CP132900 |
| Coordinates | 740446..740607 (-) | Length | 53 a.a. |
| NCBI ID | WP_014727422.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain CICC 20372 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 740446..748303 | 740446..740607 | within | 0 |
Gene organization within MGE regions
Location: 740446..748303
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RA106_RS03935 (RA106_03945) | prx | 740446..740607 (-) | 162 | WP_014727422.1 | hypothetical protein | Regulator |
| RA106_RS03940 (RA106_03950) | - | 741091..741366 (-) | 276 | WP_014727423.1 | hypothetical protein | - |
| RA106_RS03945 (RA106_03955) | - | 741383..741568 (-) | 186 | WP_024704073.1 | hypothetical protein | - |
| RA106_RS03950 (RA106_03960) | - | 741866..743371 (-) | 1506 | WP_024704074.1 | phage/plasmid primase, P4 family | - |
| RA106_RS03955 (RA106_03965) | - | 743361..744221 (-) | 861 | WP_024704075.1 | primase alpha helix C-terminal domain-containing protein | - |
| RA106_RS03960 (RA106_03970) | - | 744236..744508 (-) | 273 | WP_011227098.1 | MerR family transcriptional regulator | - |
| RA106_RS03965 (RA106_03975) | - | 744751..744987 (-) | 237 | WP_024704076.1 | hypothetical protein | - |
| RA106_RS03970 (RA106_03980) | - | 745001..745195 (-) | 195 | WP_024704077.1 | hypothetical protein | - |
| RA106_RS03975 (RA106_03985) | - | 745199..745492 (-) | 294 | WP_024704078.1 | hypothetical protein | - |
| RA106_RS03980 (RA106_03990) | - | 745731..745928 (-) | 198 | WP_014608200.1 | helix-turn-helix transcriptional regulator | - |
| RA106_RS03985 (RA106_03995) | - | 746109..746603 (+) | 495 | WP_370869443.1 | helix-turn-helix transcriptional regulator | - |
| RA106_RS03990 (RA106_04000) | - | 746686..747852 (+) | 1167 | WP_011227104.1 | site-specific integrase | - |
| RA106_RS03995 (RA106_04005) | - | 747968..748303 (+) | 336 | WP_002948199.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 53 a.a. Molecular weight: 6084.95 Da Isoelectric Point: 4.2412
>NTDB_id=870543 RA106_RS03935 WP_014727422.1 740446..740607(-) (prx) [Streptococcus thermophilus strain CICC 20372]
MLTYDEFKEAMDKGFIKGDTVQIVRLDGEQVEPREILSLEKVSDIIKELGKDN
MLTYDEFKEAMDKGFIKGDTVQIVRLDGEQVEPREILSLEKVSDIIKELGKDN
Nucleotide
Download Length: 162 bp
>NTDB_id=870543 RA106_RS03935 WP_014727422.1 740446..740607(-) (prx) [Streptococcus thermophilus strain CICC 20372]
ATGCTGACTTATGATGAATTTAAAGAGGCAATGGACAAGGGTTTTATTAAAGGTGATACTGTCCAGATTGTCCGATTAGA
CGGTGAACAAGTTGAGCCACGCGAAATATTGAGCTTAGAAAAGGTATCGGATATAATAAAGGAACTAGGCAAGGACAACT
AA
ATGCTGACTTATGATGAATTTAAAGAGGCAATGGACAAGGGTTTTATTAAAGGTGATACTGTCCAGATTGTCCGATTAGA
CGGTGAACAAGTTGAGCCACGCGAAATATTGAGCTTAGAAAAGGTATCGGATATAATAAAGGAACTAGGCAAGGACAACT
AA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
48.333 |
100 |
0.547 |
| prx | Streptococcus pyogenes MGAS315 |
46.667 |
100 |
0.528 |
| prx | Streptococcus pyogenes MGAS315 |
46.667 |
100 |
0.528 |
| prx | Streptococcus pyogenes MGAS315 |
45 |
100 |
0.509 |
| prx | Streptococcus pyogenes MGAS315 |
56.818 |
83.019 |
0.472 |
| prx | Streptococcus pyogenes MGAS315 |
57.143 |
79.245 |
0.453 |
| prx | Streptococcus pyogenes MGAS315 |
60.526 |
71.698 |
0.434 |