Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | RAM32_RS14070 | Genome accession | NZ_CP132361 |
| Coordinates | 2806776..2807246 (-) | Length | 156 a.a. |
| NCBI ID | WP_000934762.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain UNC_SA56 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2775758..2829421 | 2806776..2807246 | within | 0 |
Gene organization within MGE regions
Location: 2775758..2829421
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RAM32_RS13840 (RAM32_13830) | scn | 2775758..2776108 (-) | 351 | WP_031906254.1 | complement inhibitor SCIN-A | - |
| RAM32_RS13845 (RAM32_13835) | - | 2776619..2776957 (-) | 339 | Protein_2687 | SH3 domain-containing protein | - |
| RAM32_RS13850 (RAM32_13840) | sak | 2777605..2778096 (-) | 492 | WP_000920038.1 | staphylokinase | - |
| RAM32_RS13855 (RAM32_13845) | - | 2778287..2779042 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| RAM32_RS13860 (RAM32_13850) | - | 2779054..2779308 (-) | 255 | WP_000611512.1 | phage holin | - |
| RAM32_RS13865 (RAM32_13855) | - | 2779360..2779467 (+) | 108 | WP_001791821.1 | hypothetical protein | - |
| RAM32_RS13870 (RAM32_13860) | pepG1 | 2779520..2779654 (-) | 135 | WP_000880502.1 | type I toxin-antitoxin system toxin PepG1 | - |
| RAM32_RS13875 (RAM32_13865) | - | 2779839..2780213 (-) | 375 | WP_000340977.1 | hypothetical protein | - |
| RAM32_RS13880 (RAM32_13870) | - | 2780269..2780556 (-) | 288 | WP_001262620.1 | hypothetical protein | - |
| RAM32_RS13885 (RAM32_13875) | - | 2780602..2780754 (-) | 153 | WP_001000058.1 | hypothetical protein | - |
| RAM32_RS13890 (RAM32_13880) | - | 2780747..2784529 (-) | 3783 | WP_000582132.1 | phage tail spike protein | - |
| RAM32_RS13895 (RAM32_13885) | - | 2784545..2786035 (-) | 1491 | WP_153157938.1 | phage distal tail protein | - |
| RAM32_RS13900 (RAM32_13890) | - | 2786035..2790684 (-) | 4650 | WP_031906215.1 | phage tail tape measure protein | - |
| RAM32_RS13905 (RAM32_13895) | gpGT | 2790740..2790862 (-) | 123 | WP_000571956.1 | phage tail assembly chaperone GT | - |
| RAM32_RS13910 (RAM32_13900) | gpG | 2790922..2791368 (-) | 447 | WP_000442601.1 | phage tail assembly chaperone G | - |
| RAM32_RS13915 (RAM32_13905) | - | 2791433..2792386 (-) | 954 | WP_000570652.1 | major tail protein | - |
| RAM32_RS13920 (RAM32_13910) | - | 2792387..2792767 (-) | 381 | WP_000611449.1 | hypothetical protein | - |
| RAM32_RS13925 (RAM32_13915) | - | 2792764..2793141 (-) | 378 | WP_000501244.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| RAM32_RS13930 (RAM32_13920) | - | 2793141..2793476 (-) | 336 | WP_000975314.1 | head-tail adaptor protein | - |
| RAM32_RS13935 (RAM32_13925) | - | 2793463..2793795 (-) | 333 | WP_031906214.1 | head-tail connector protein | - |
| RAM32_RS13940 (RAM32_13930) | - | 2793804..2793962 (-) | 159 | WP_001252099.1 | hypothetical protein | - |
| RAM32_RS13945 (RAM32_13935) | - | 2793998..2795245 (-) | 1248 | WP_000849957.1 | phage major capsid protein | - |
| RAM32_RS13950 (RAM32_13940) | - | 2795333..2795917 (-) | 585 | WP_000032523.1 | HK97 family phage prohead protease | - |
| RAM32_RS13955 (RAM32_13945) | - | 2795910..2797160 (-) | 1251 | WP_000511064.1 | phage portal protein | - |
| RAM32_RS13960 (RAM32_13950) | - | 2797166..2797366 (-) | 201 | WP_000365301.1 | hypothetical protein | - |
| RAM32_RS13965 (RAM32_13955) | - | 2797380..2799074 (-) | 1695 | WP_000133304.1 | terminase large subunit | - |
| RAM32_RS13970 (RAM32_13960) | - | 2799077..2799544 (-) | 468 | WP_000919026.1 | phage terminase small subunit P27 family | - |
| RAM32_RS13975 (RAM32_13965) | - | 2799672..2800016 (-) | 345 | WP_000817289.1 | HNH endonuclease | - |
| RAM32_RS13980 (RAM32_13970) | - | 2800032..2800484 (-) | 453 | WP_000406191.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| RAM32_RS13985 (RAM32_13975) | - | 2800599..2801069 (-) | 471 | WP_000282758.1 | hypothetical protein | - |
| RAM32_RS13990 (RAM32_13980) | - | 2801092..2801292 (-) | 201 | WP_000265041.1 | DUF1514 family protein | - |
| RAM32_RS13995 (RAM32_13985) | - | 2801292..2801942 (-) | 651 | WP_001005262.1 | hypothetical protein | - |
| RAM32_RS14000 (RAM32_13990) | rinB | 2802101..2802250 (-) | 150 | WP_000595305.1 | transcriptional activator RinB | - |
| RAM32_RS14005 (RAM32_13995) | - | 2802247..2802633 (-) | 387 | WP_000592201.1 | hypothetical protein | - |
| RAM32_RS14010 (RAM32_14000) | - | 2802630..2802836 (-) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| RAM32_RS14015 (RAM32_14005) | - | 2802833..2803078 (-) | 246 | WP_001282074.1 | hypothetical protein | - |
| RAM32_RS14020 (RAM32_14010) | - | 2803115..2803648 (-) | 534 | WP_001061838.1 | dUTPase | - |
| RAM32_RS14025 (RAM32_14015) | - | 2803663..2803824 (-) | 162 | WP_000889682.1 | hypothetical protein | - |
| RAM32_RS14030 (RAM32_14020) | - | 2803825..2804082 (-) | 258 | WP_153157937.1 | hypothetical protein | - |
| RAM32_RS14035 (RAM32_14025) | - | 2804108..2804281 (-) | 174 | WP_000028424.1 | hypothetical protein | - |
| RAM32_RS14040 (RAM32_14030) | - | 2804271..2804522 (-) | 252 | WP_001065046.1 | DUF1024 family protein | - |
| RAM32_RS14045 (RAM32_14035) | - | 2804537..2804779 (-) | 243 | WP_000131381.1 | phi PVL orf 51-like protein | - |
| RAM32_RS14050 (RAM32_14040) | - | 2804783..2805151 (-) | 369 | WP_000101270.1 | SA1788 family PVL leukocidin-associated protein | - |
| RAM32_RS14055 (RAM32_14045) | - | 2805164..2805619 (-) | 456 | WP_000401965.1 | RusA family crossover junction endodeoxyribonuclease | - |
| RAM32_RS14060 (RAM32_14050) | - | 2805628..2805846 (-) | 219 | WP_000338527.1 | hypothetical protein | - |
| RAM32_RS14065 (RAM32_14055) | - | 2805853..2806746 (-) | 894 | WP_000148327.1 | DnaD domain-containing protein | - |
| RAM32_RS14070 (RAM32_14060) | ssbA | 2806776..2807246 (-) | 471 | WP_000934762.1 | single-stranded DNA-binding protein | Machinery gene |
| RAM32_RS14075 (RAM32_14065) | - | 2807247..2807864 (-) | 618 | WP_072353921.1 | MBL fold metallo-hydrolase | - |
| RAM32_RS14080 (RAM32_14070) | - | 2807945..2808865 (-) | 921 | WP_000138475.1 | recombinase RecT | - |
| RAM32_RS14085 (RAM32_14075) | - | 2808867..2810822 (-) | 1956 | WP_048519603.1 | AAA family ATPase | - |
| RAM32_RS14090 (RAM32_14080) | - | 2810819..2811082 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| RAM32_RS14095 (RAM32_14085) | - | 2811091..2811351 (-) | 261 | WP_000291489.1 | DUF1108 family protein | - |
| RAM32_RS14100 (RAM32_14090) | - | 2811444..2811605 (-) | 162 | WP_000066020.1 | DUF1270 domain-containing protein | - |
| RAM32_RS14105 (RAM32_14095) | - | 2811602..2811922 (-) | 321 | WP_001120935.1 | DUF771 domain-containing protein | - |
| RAM32_RS14110 (RAM32_14100) | - | 2811981..2812208 (+) | 228 | WP_000801108.1 | hypothetical protein | - |
| RAM32_RS14115 (RAM32_14105) | - | 2812210..2812401 (-) | 192 | WP_000389906.1 | hypothetical protein | - |
| RAM32_RS14120 (RAM32_14110) | - | 2812451..2812807 (+) | 357 | WP_000768245.1 | DUF2513 domain-containing protein | - |
| RAM32_RS14125 (RAM32_14115) | - | 2812802..2812996 (-) | 195 | WP_001148852.1 | hypothetical protein | - |
| RAM32_RS14130 (RAM32_14120) | - | 2813012..2813764 (-) | 753 | WP_306181358.1 | phage antirepressor KilAC domain-containing protein | - |
| RAM32_RS14135 (RAM32_14125) | - | 2813921..2814229 (-) | 309 | WP_001153965.1 | hypothetical protein | - |
| RAM32_RS14140 (RAM32_14130) | - | 2814244..2814462 (-) | 219 | WP_001198673.1 | helix-turn-helix transcriptional regulator | - |
| RAM32_RS14145 (RAM32_14135) | - | 2814604..2815323 (+) | 720 | WP_000358221.1 | XRE family transcriptional regulator | - |
| RAM32_RS14150 (RAM32_14140) | - | 2815523..2815705 (+) | 183 | WP_000705240.1 | hypothetical protein | - |
| RAM32_RS14155 (RAM32_14145) | - | 2815741..2815887 (+) | 147 | WP_001013104.1 | hypothetical protein | - |
| RAM32_RS14160 (RAM32_14150) | - | 2815884..2816498 (-) | 615 | WP_000191459.1 | hypothetical protein | - |
| RAM32_RS14165 (RAM32_14155) | - | 2816606..2817643 (+) | 1038 | WP_000857176.1 | site-specific integrase | - |
| RAM32_RS14170 (RAM32_14160) | sph | 2817700..2818524 (+) | 825 | Protein_2752 | sphingomyelin phosphodiesterase | - |
| RAM32_RS14175 (RAM32_14165) | lukG | 2818762..2819778 (-) | 1017 | WP_000595401.1 | bi-component leukocidin LukGH subunit G | - |
| RAM32_RS14180 (RAM32_14170) | lukH | 2819800..2820852 (-) | 1053 | WP_000791415.1 | bi-component leukocidin LukGH subunit H | - |
| RAM32_RS14185 (RAM32_14175) | - | 2821288..2822511 (+) | 1224 | WP_000206630.1 | ArgE/DapE family deacylase | - |
| RAM32_RS14190 (RAM32_14180) | - | 2823009..2823878 (-) | 870 | WP_064127829.1 | DMT family transporter | - |
| RAM32_RS14195 (RAM32_14185) | hemA | 2823881..2825083 (-) | 1203 | WP_000278575.1 | 5-aminolevulinate synthase | - |
| RAM32_RS14200 (RAM32_14190) | - | 2825599..2826906 (+) | 1308 | WP_001045345.1 | TrkH family potassium uptake protein | - |
| RAM32_RS14205 (RAM32_14195) | groL | 2827445..2829061 (-) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| RAM32_RS14210 (RAM32_14200) | groES | 2829137..2829421 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17673.58 Da Isoelectric Point: 5.2670
>NTDB_id=868471 RAM32_RS14070 WP_000934762.1 2806776..2807246(-) (ssbA) [Staphylococcus aureus strain UNC_SA56]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANCPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANCPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=868471 RAM32_RS14070 WP_000934762.1 2806776..2807246(-) (ssbA) [Staphylococcus aureus strain UNC_SA56]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTAAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATTGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTAAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATTGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.558 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Vibrio cholerae strain A1552 |
31.492 |
100 |
0.365 |
| ssb | Neisseria meningitidis MC58 |
32.948 |
100 |
0.365 |
| ssb | Neisseria gonorrhoeae MS11 |
32.948 |
100 |
0.365 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |