Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   RAM32_RS14070 Genome accession   NZ_CP132361
Coordinates   2806776..2807246 (-) Length   156 a.a.
NCBI ID   WP_000934762.1    Uniprot ID   -
Organism   Staphylococcus aureus strain UNC_SA56     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2775758..2829421 2806776..2807246 within 0


Gene organization within MGE regions


Location: 2775758..2829421
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RAM32_RS13840 (RAM32_13830) scn 2775758..2776108 (-) 351 WP_031906254.1 complement inhibitor SCIN-A -
  RAM32_RS13845 (RAM32_13835) - 2776619..2776957 (-) 339 Protein_2687 SH3 domain-containing protein -
  RAM32_RS13850 (RAM32_13840) sak 2777605..2778096 (-) 492 WP_000920038.1 staphylokinase -
  RAM32_RS13855 (RAM32_13845) - 2778287..2779042 (-) 756 WP_000861038.1 CHAP domain-containing protein -
  RAM32_RS13860 (RAM32_13850) - 2779054..2779308 (-) 255 WP_000611512.1 phage holin -
  RAM32_RS13865 (RAM32_13855) - 2779360..2779467 (+) 108 WP_001791821.1 hypothetical protein -
  RAM32_RS13870 (RAM32_13860) pepG1 2779520..2779654 (-) 135 WP_000880502.1 type I toxin-antitoxin system toxin PepG1 -
  RAM32_RS13875 (RAM32_13865) - 2779839..2780213 (-) 375 WP_000340977.1 hypothetical protein -
  RAM32_RS13880 (RAM32_13870) - 2780269..2780556 (-) 288 WP_001262620.1 hypothetical protein -
  RAM32_RS13885 (RAM32_13875) - 2780602..2780754 (-) 153 WP_001000058.1 hypothetical protein -
  RAM32_RS13890 (RAM32_13880) - 2780747..2784529 (-) 3783 WP_000582132.1 phage tail spike protein -
  RAM32_RS13895 (RAM32_13885) - 2784545..2786035 (-) 1491 WP_153157938.1 phage distal tail protein -
  RAM32_RS13900 (RAM32_13890) - 2786035..2790684 (-) 4650 WP_031906215.1 phage tail tape measure protein -
  RAM32_RS13905 (RAM32_13895) gpGT 2790740..2790862 (-) 123 WP_000571956.1 phage tail assembly chaperone GT -
  RAM32_RS13910 (RAM32_13900) gpG 2790922..2791368 (-) 447 WP_000442601.1 phage tail assembly chaperone G -
  RAM32_RS13915 (RAM32_13905) - 2791433..2792386 (-) 954 WP_000570652.1 major tail protein -
  RAM32_RS13920 (RAM32_13910) - 2792387..2792767 (-) 381 WP_000611449.1 hypothetical protein -
  RAM32_RS13925 (RAM32_13915) - 2792764..2793141 (-) 378 WP_000501244.1 HK97-gp10 family putative phage morphogenesis protein -
  RAM32_RS13930 (RAM32_13920) - 2793141..2793476 (-) 336 WP_000975314.1 head-tail adaptor protein -
  RAM32_RS13935 (RAM32_13925) - 2793463..2793795 (-) 333 WP_031906214.1 head-tail connector protein -
  RAM32_RS13940 (RAM32_13930) - 2793804..2793962 (-) 159 WP_001252099.1 hypothetical protein -
  RAM32_RS13945 (RAM32_13935) - 2793998..2795245 (-) 1248 WP_000849957.1 phage major capsid protein -
  RAM32_RS13950 (RAM32_13940) - 2795333..2795917 (-) 585 WP_000032523.1 HK97 family phage prohead protease -
  RAM32_RS13955 (RAM32_13945) - 2795910..2797160 (-) 1251 WP_000511064.1 phage portal protein -
  RAM32_RS13960 (RAM32_13950) - 2797166..2797366 (-) 201 WP_000365301.1 hypothetical protein -
  RAM32_RS13965 (RAM32_13955) - 2797380..2799074 (-) 1695 WP_000133304.1 terminase large subunit -
  RAM32_RS13970 (RAM32_13960) - 2799077..2799544 (-) 468 WP_000919026.1 phage terminase small subunit P27 family -
  RAM32_RS13975 (RAM32_13965) - 2799672..2800016 (-) 345 WP_000817289.1 HNH endonuclease -
  RAM32_RS13980 (RAM32_13970) - 2800032..2800484 (-) 453 WP_000406191.1 nucleoside triphosphate pyrophosphohydrolase family protein -
  RAM32_RS13985 (RAM32_13975) - 2800599..2801069 (-) 471 WP_000282758.1 hypothetical protein -
  RAM32_RS13990 (RAM32_13980) - 2801092..2801292 (-) 201 WP_000265041.1 DUF1514 family protein -
  RAM32_RS13995 (RAM32_13985) - 2801292..2801942 (-) 651 WP_001005262.1 hypothetical protein -
  RAM32_RS14000 (RAM32_13990) rinB 2802101..2802250 (-) 150 WP_000595305.1 transcriptional activator RinB -
  RAM32_RS14005 (RAM32_13995) - 2802247..2802633 (-) 387 WP_000592201.1 hypothetical protein -
  RAM32_RS14010 (RAM32_14000) - 2802630..2802836 (-) 207 WP_000195803.1 DUF1381 domain-containing protein -
  RAM32_RS14015 (RAM32_14005) - 2802833..2803078 (-) 246 WP_001282074.1 hypothetical protein -
  RAM32_RS14020 (RAM32_14010) - 2803115..2803648 (-) 534 WP_001061838.1 dUTPase -
  RAM32_RS14025 (RAM32_14015) - 2803663..2803824 (-) 162 WP_000889682.1 hypothetical protein -
  RAM32_RS14030 (RAM32_14020) - 2803825..2804082 (-) 258 WP_153157937.1 hypothetical protein -
  RAM32_RS14035 (RAM32_14025) - 2804108..2804281 (-) 174 WP_000028424.1 hypothetical protein -
  RAM32_RS14040 (RAM32_14030) - 2804271..2804522 (-) 252 WP_001065046.1 DUF1024 family protein -
  RAM32_RS14045 (RAM32_14035) - 2804537..2804779 (-) 243 WP_000131381.1 phi PVL orf 51-like protein -
  RAM32_RS14050 (RAM32_14040) - 2804783..2805151 (-) 369 WP_000101270.1 SA1788 family PVL leukocidin-associated protein -
  RAM32_RS14055 (RAM32_14045) - 2805164..2805619 (-) 456 WP_000401965.1 RusA family crossover junction endodeoxyribonuclease -
  RAM32_RS14060 (RAM32_14050) - 2805628..2805846 (-) 219 WP_000338527.1 hypothetical protein -
  RAM32_RS14065 (RAM32_14055) - 2805853..2806746 (-) 894 WP_000148327.1 DnaD domain-containing protein -
  RAM32_RS14070 (RAM32_14060) ssbA 2806776..2807246 (-) 471 WP_000934762.1 single-stranded DNA-binding protein Machinery gene
  RAM32_RS14075 (RAM32_14065) - 2807247..2807864 (-) 618 WP_072353921.1 MBL fold metallo-hydrolase -
  RAM32_RS14080 (RAM32_14070) - 2807945..2808865 (-) 921 WP_000138475.1 recombinase RecT -
  RAM32_RS14085 (RAM32_14075) - 2808867..2810822 (-) 1956 WP_048519603.1 AAA family ATPase -
  RAM32_RS14090 (RAM32_14080) - 2810819..2811082 (-) 264 WP_001205732.1 hypothetical protein -
  RAM32_RS14095 (RAM32_14085) - 2811091..2811351 (-) 261 WP_000291489.1 DUF1108 family protein -
  RAM32_RS14100 (RAM32_14090) - 2811444..2811605 (-) 162 WP_000066020.1 DUF1270 domain-containing protein -
  RAM32_RS14105 (RAM32_14095) - 2811602..2811922 (-) 321 WP_001120935.1 DUF771 domain-containing protein -
  RAM32_RS14110 (RAM32_14100) - 2811981..2812208 (+) 228 WP_000801108.1 hypothetical protein -
  RAM32_RS14115 (RAM32_14105) - 2812210..2812401 (-) 192 WP_000389906.1 hypothetical protein -
  RAM32_RS14120 (RAM32_14110) - 2812451..2812807 (+) 357 WP_000768245.1 DUF2513 domain-containing protein -
  RAM32_RS14125 (RAM32_14115) - 2812802..2812996 (-) 195 WP_001148852.1 hypothetical protein -
  RAM32_RS14130 (RAM32_14120) - 2813012..2813764 (-) 753 WP_306181358.1 phage antirepressor KilAC domain-containing protein -
  RAM32_RS14135 (RAM32_14125) - 2813921..2814229 (-) 309 WP_001153965.1 hypothetical protein -
  RAM32_RS14140 (RAM32_14130) - 2814244..2814462 (-) 219 WP_001198673.1 helix-turn-helix transcriptional regulator -
  RAM32_RS14145 (RAM32_14135) - 2814604..2815323 (+) 720 WP_000358221.1 XRE family transcriptional regulator -
  RAM32_RS14150 (RAM32_14140) - 2815523..2815705 (+) 183 WP_000705240.1 hypothetical protein -
  RAM32_RS14155 (RAM32_14145) - 2815741..2815887 (+) 147 WP_001013104.1 hypothetical protein -
  RAM32_RS14160 (RAM32_14150) - 2815884..2816498 (-) 615 WP_000191459.1 hypothetical protein -
  RAM32_RS14165 (RAM32_14155) - 2816606..2817643 (+) 1038 WP_000857176.1 site-specific integrase -
  RAM32_RS14170 (RAM32_14160) sph 2817700..2818524 (+) 825 Protein_2752 sphingomyelin phosphodiesterase -
  RAM32_RS14175 (RAM32_14165) lukG 2818762..2819778 (-) 1017 WP_000595401.1 bi-component leukocidin LukGH subunit G -
  RAM32_RS14180 (RAM32_14170) lukH 2819800..2820852 (-) 1053 WP_000791415.1 bi-component leukocidin LukGH subunit H -
  RAM32_RS14185 (RAM32_14175) - 2821288..2822511 (+) 1224 WP_000206630.1 ArgE/DapE family deacylase -
  RAM32_RS14190 (RAM32_14180) - 2823009..2823878 (-) 870 WP_064127829.1 DMT family transporter -
  RAM32_RS14195 (RAM32_14185) hemA 2823881..2825083 (-) 1203 WP_000278575.1 5-aminolevulinate synthase -
  RAM32_RS14200 (RAM32_14190) - 2825599..2826906 (+) 1308 WP_001045345.1 TrkH family potassium uptake protein -
  RAM32_RS14205 (RAM32_14195) groL 2827445..2829061 (-) 1617 WP_000240642.1 chaperonin GroEL -
  RAM32_RS14210 (RAM32_14200) groES 2829137..2829421 (-) 285 WP_000917289.1 co-chaperone GroES -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17673.58 Da        Isoelectric Point: 5.2670

>NTDB_id=868471 RAM32_RS14070 WP_000934762.1 2806776..2807246(-) (ssbA) [Staphylococcus aureus strain UNC_SA56]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANCPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=868471 RAM32_RS14070 WP_000934762.1 2806776..2807246(-) (ssbA) [Staphylococcus aureus strain UNC_SA56]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTAAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATTGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.932

100

0.635

  ssb Latilactobacillus sakei subsp. sakei 23K

51.176

100

0.558

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Vibrio cholerae strain A1552

31.492

100

0.365

  ssb Neisseria meningitidis MC58

32.948

100

0.365

  ssb Neisseria gonorrhoeae MS11

32.948

100

0.365

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365