Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | WHL49_RS12195 | Genome accession | NZ_CP148103 |
| Coordinates | 2393815..2393988 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0ABU0V3E4 |
| Organism | Bacillus subtilis subsp. subtilis isolate FELIX_MS361 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2388815..2398988
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WHL49_RS12180 | gcvT | 2389614..2390702 (-) | 1089 | WP_004398598.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| WHL49_RS12185 | yqhH | 2391144..2392817 (+) | 1674 | WP_004398544.1 | SNF2-related protein | - |
| WHL49_RS12190 | yqhG | 2392838..2393632 (+) | 795 | WP_003230200.1 | YqhG family protein | - |
| WHL49_RS12195 | sinI | 2393815..2393988 (+) | 174 | WP_003230187.1 | anti-repressor SinI family protein | Regulator |
| WHL49_RS12200 | sinR | 2394022..2394357 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| WHL49_RS12205 | tasA | 2394450..2395235 (-) | 786 | WP_004398632.1 | biofilm matrix protein TasA | - |
| WHL49_RS12210 | sipW | 2395299..2395871 (-) | 573 | WP_003246088.1 | signal peptidase I | - |
| WHL49_RS12215 | tapA | 2395855..2396616 (-) | 762 | WP_004399106.1 | amyloid fiber anchoring/assembly protein TapA | - |
| WHL49_RS12220 | yqzG | 2396888..2397214 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| WHL49_RS12225 | spoIIT | 2397256..2397435 (-) | 180 | WP_003230176.1 | YqzE family protein | - |
| WHL49_RS12230 | comGG | 2397506..2397880 (-) | 375 | WP_003230170.1 | ComG operon protein ComGG | Machinery gene |
| WHL49_RS12235 | comGF | 2397881..2398264 (-) | 384 | WP_003230168.1 | ComG operon protein ComGF | Machinery gene |
| WHL49_RS12240 | comGE | 2398290..2398637 (-) | 348 | WP_003230165.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=864072 WHL49_RS12195 WP_003230187.1 2393815..2393988(+) (sinI) [Bacillus subtilis subsp. subtilis isolate FELIX_MS361]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=864072 WHL49_RS12195 WP_003230187.1 2393815..2393988(+) (sinI) [Bacillus subtilis subsp. subtilis isolate FELIX_MS361]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |