Detailed information
Bioinformatically predicted
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | STYK_RS10210 | Genome accession | NZ_AP024523 |
| Coordinates | 2051843..2051965 (-) | Length | 40 a.a. |
| NCBI ID | WP_060627323.1 | Uniprot ID | - |
| Organism | Streptococcus toyakuensis strain TP1632 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2046843..2056965
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| STYK_RS10185 (STYK_19580) | - | 2048970..2049512 (+) | 543 | WP_001158273.1 | TetR/AcrR family transcriptional regulator | - |
| STYK_RS10200 (STYK_19590) | comE | 2049755..2050508 (-) | 754 | Protein_1963 | competence system response regulator transcription factor ComE | - |
| STYK_RS10205 (STYK_19600) | comD/comD1 | 2050505..2051830 (-) | 1326 | WP_084923904.1 | competence system sensor histidine kinase ComD | Regulator |
| STYK_RS10210 (STYK_19610) | comC/comC2 | 2051843..2051965 (-) | 123 | WP_060627323.1 | competence-stimulating peptide ComC | Regulator |
| STYK_RS10220 (STYK_19620) | rlmH | 2052247..2052726 (-) | 480 | WP_060627322.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| STYK_RS10225 (STYK_19630) | htrA | 2052910..2054091 (+) | 1182 | WP_060627321.1 | S1C family serine protease | Regulator |
| STYK_RS10230 (STYK_19640) | spo0J | 2054149..2054907 (+) | 759 | WP_020902614.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 40 a.a. Molecular weight: 4814.65 Da Isoelectric Point: 11.0668
>NTDB_id=85780 STYK_RS10210 WP_060627323.1 2051843..2051965(-) (comC/comC2) [Streptococcus toyakuensis strain TP1632]
MKNTVKLEQFVALKEKDLQKIQGGEMRKSNNNFFNFLRRI
MKNTVKLEQFVALKEKDLQKIQGGEMRKSNNNFFNFLRRI
Nucleotide
Download Length: 123 bp
>NTDB_id=85780 STYK_RS10210 WP_060627323.1 2051843..2051965(-) (comC/comC2) [Streptococcus toyakuensis strain TP1632]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCCTTGAAGGAAAAAGACTTGCAAAAGATTCAAGGTGGGGAGATGAG
GAAATCAAATAATAATTTCTTTAATTTCTTAAGAAGAATATAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCCTTGAAGGAAAAAGACTTGCAAAAGATTCAAGGTGGGGAGATGAG
GAAATCAAATAATAATTTCTTTAATTTCTTAAGAAGAATATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
77.5 |
100 |
0.775 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
77.5 |
100 |
0.775 |
| comC | Streptococcus mitis SK321 |
72.5 |
100 |
0.725 |
| comC | Streptococcus mitis NCTC 12261 |
69.231 |
97.5 |
0.675 |
| comC/comC1 | Streptococcus pneumoniae G54 |
93.103 |
72.5 |
0.675 |
| comC/comC1 | Streptococcus pneumoniae D39 |
93.103 |
72.5 |
0.675 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
93.103 |
72.5 |
0.675 |
| comC/comC1 | Streptococcus pneumoniae R6 |
93.103 |
72.5 |
0.675 |