Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | QYE81_RS08535 | Genome accession | NZ_CP129362 |
| Coordinates | 1725377..1725826 (-) | Length | 149 a.a. |
| NCBI ID | WP_301400712.1 | Uniprot ID | - |
| Organism | Staphylococcus haemolyticus strain CCSH-121 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1691450..1734904 | 1725377..1725826 | within | 0 |
Gene organization within MGE regions
Location: 1691450..1734904
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QYE81_RS08300 | - | 1691450..1691983 (-) | 534 | WP_180548761.1 | hypothetical protein | - |
| QYE81_RS08305 | - | 1692158..1693867 (-) | 1710 | WP_053022036.1 | N-acetylmuramoyl-L-alanine amidase | - |
| QYE81_RS08310 | - | 1693867..1694166 (-) | 300 | WP_053022037.1 | hypothetical protein | - |
| QYE81_RS08315 | - | 1694217..1694615 (-) | 399 | WP_053021451.1 | hypothetical protein | - |
| QYE81_RS08320 | - | 1694599..1695018 (-) | 420 | WP_037549617.1 | hypothetical protein | - |
| QYE81_RS08325 | - | 1695030..1695329 (-) | 300 | WP_037549614.1 | hypothetical protein | - |
| QYE81_RS08330 | - | 1695373..1695528 (-) | 156 | WP_037549611.1 | hypothetical protein | - |
| QYE81_RS08335 | - | 1695506..1700485 (-) | 4980 | WP_301400645.1 | phage tail spike protein | - |
| QYE81_RS08340 | - | 1700501..1701994 (-) | 1494 | WP_301400648.1 | phage tail domain-containing protein | - |
| QYE81_RS08345 | - | 1702005..1707332 (-) | 5328 | WP_301400651.1 | peptidoglycan DD-metalloendopeptidase family protein | - |
| QYE81_RS08350 | - | 1707536..1708069 (-) | 534 | WP_301400654.1 | hypothetical protein | - |
| QYE81_RS08355 | - | 1708141..1708731 (-) | 591 | WP_301400657.1 | major tail protein | - |
| QYE81_RS08360 | - | 1708738..1709136 (-) | 399 | WP_301400660.1 | hypothetical protein | - |
| QYE81_RS08365 | - | 1709126..1709551 (-) | 426 | WP_053018031.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| QYE81_RS08370 | - | 1709551..1709874 (-) | 324 | WP_053018032.1 | phage head closure protein | - |
| QYE81_RS08375 | - | 1709844..1710167 (-) | 324 | WP_053018033.1 | head-tail connector protein | - |
| QYE81_RS08380 | - | 1710176..1710349 (-) | 174 | WP_176715140.1 | hypothetical protein | - |
| QYE81_RS08385 | - | 1710364..1711668 (-) | 1305 | WP_301400664.1 | phage major capsid protein | - |
| QYE81_RS08390 | - | 1711717..1712277 (-) | 561 | WP_256277962.1 | HK97 family phage prohead protease | - |
| QYE81_RS08395 | - | 1712258..1713505 (-) | 1248 | WP_301400667.1 | phage portal protein | - |
| QYE81_RS08400 | - | 1713505..1713681 (-) | 177 | WP_154266293.1 | hypothetical protein | - |
| QYE81_RS08405 | - | 1713695..1715446 (-) | 1752 | WP_301400670.1 | terminase TerL endonuclease subunit | - |
| QYE81_RS08410 | - | 1715439..1715909 (-) | 471 | WP_301400673.1 | phage terminase small subunit P27 family | - |
| QYE81_RS08415 | - | 1716045..1716434 (-) | 390 | WP_363324738.1 | HNH endonuclease signature motif containing protein | - |
| QYE81_RS08420 | - | 1716558..1717007 (-) | 450 | WP_301400676.1 | hypothetical protein | - |
| QYE81_RS08425 | - | 1717021..1717242 (-) | 222 | WP_301400679.1 | helix-turn-helix transcriptional regulator | - |
| QYE81_RS08430 | - | 1717247..1717435 (-) | 189 | WP_301400682.1 | DUF1514 family protein | - |
| QYE81_RS08435 | - | 1717439..1717666 (-) | 228 | WP_145453551.1 | hypothetical protein | - |
| QYE81_RS08440 | - | 1717666..1717848 (-) | 183 | WP_301400685.1 | transcriptional regulator | - |
| QYE81_RS08445 | - | 1717854..1718063 (-) | 210 | WP_301400688.1 | DUF1381 domain-containing protein | - |
| QYE81_RS08450 | - | 1718302..1718574 (-) | 273 | WP_301400691.1 | hypothetical protein | - |
| QYE81_RS08455 | - | 1718733..1718921 (-) | 189 | WP_240558820.1 | hypothetical protein | - |
| QYE81_RS08460 | dut | 1718961..1719383 (-) | 423 | WP_301400694.1 | dUTP diphosphatase | - |
| QYE81_RS08465 | - | 1719384..1719611 (-) | 228 | WP_053034965.1 | hypothetical protein | - |
| QYE81_RS08470 | - | 1719612..1719860 (-) | 249 | WP_053034964.1 | hypothetical protein | - |
| QYE81_RS08475 | - | 1719879..1720058 (-) | 180 | WP_049394860.1 | hypothetical protein | - |
| QYE81_RS08480 | - | 1720045..1720242 (-) | 198 | WP_301400697.1 | hypothetical protein | - |
| QYE81_RS08485 | - | 1720229..1720684 (-) | 456 | WP_011276628.1 | DUF3310 domain-containing protein | - |
| QYE81_RS08490 | - | 1720689..1721249 (-) | 561 | WP_301400700.1 | SA1788 family PVL leukocidin-associated protein | - |
| QYE81_RS08495 | - | 1721254..1721448 (-) | 195 | WP_301400703.1 | hypothetical protein | - |
| QYE81_RS08500 | - | 1721448..1721852 (-) | 405 | WP_145411808.1 | RusA family crossover junction endodeoxyribonuclease | - |
| QYE81_RS08505 | - | 1721863..1722105 (-) | 243 | WP_053019983.1 | hypothetical protein | - |
| QYE81_RS08510 | - | 1722080..1722304 (-) | 225 | WP_034172826.1 | hypothetical protein | - |
| QYE81_RS08515 | - | 1722304..1723551 (-) | 1248 | WP_301400706.1 | DnaB helicase C-terminal domain-containing protein | - |
| QYE81_RS08520 | - | 1723538..1723900 (-) | 363 | WP_053017303.1 | hypothetical protein | - |
| QYE81_RS08525 | - | 1723907..1724695 (-) | 789 | WP_301400710.1 | phage replisome organizer N-terminal domain-containing protein | - |
| QYE81_RS08530 | - | 1724688..1725365 (-) | 678 | WP_180546675.1 | putative HNHc nuclease | - |
| QYE81_RS08535 | ssbA | 1725377..1725826 (-) | 450 | WP_301400712.1 | single-stranded DNA-binding protein | Machinery gene |
| QYE81_RS08540 | - | 1725823..1726488 (-) | 666 | WP_301400715.1 | ERF family protein | - |
| QYE81_RS08545 | - | 1726489..1726974 (-) | 486 | WP_053027820.1 | siphovirus Gp157 family protein | - |
| QYE81_RS08550 | - | 1726958..1727197 (-) | 240 | WP_053034949.1 | hypothetical protein | - |
| QYE81_RS08555 | - | 1727254..1727472 (-) | 219 | WP_053034948.1 | helix-turn-helix transcriptional regulator | - |
| QYE81_RS08560 | - | 1727477..1727650 (-) | 174 | WP_154391876.1 | hypothetical protein | - |
| QYE81_RS08565 | - | 1727653..1727970 (-) | 318 | WP_070826815.1 | DUF771 domain-containing protein | - |
| QYE81_RS08570 | - | 1728026..1728208 (+) | 183 | WP_070826813.1 | hypothetical protein | - |
| QYE81_RS08575 | - | 1728192..1728344 (-) | 153 | WP_240557151.1 | hypothetical protein | - |
| QYE81_RS08580 | - | 1728425..1729192 (-) | 768 | WP_066031847.1 | DUF6551 family protein | - |
| QYE81_RS08585 | - | 1729192..1730136 (-) | 945 | WP_301400719.1 | ParB N-terminal domain-containing protein | - |
| QYE81_RS08590 | - | 1730151..1730387 (-) | 237 | WP_301400722.1 | helix-turn-helix transcriptional regulator | - |
| QYE81_RS08595 | - | 1730539..1730853 (+) | 315 | WP_119890301.1 | helix-turn-helix transcriptional regulator | - |
| QYE81_RS08600 | - | 1730865..1731329 (+) | 465 | WP_301400725.1 | ImmA/IrrE family metallo-endopeptidase | - |
| QYE81_RS08605 | - | 1731356..1731523 (+) | 168 | WP_176715122.1 | hypothetical protein | - |
| QYE81_RS08610 | - | 1731542..1732552 (+) | 1011 | WP_037570356.1 | hypothetical protein | - |
| QYE81_RS08615 | - | 1732874..1733899 (+) | 1026 | WP_180548786.1 | site-specific integrase | - |
| QYE81_RS08620 | - | 1734395..1734904 (-) | 510 | WP_011276086.1 | metallophosphoesterase | - |
Sequence
Protein
Download Length: 149 a.a. Molecular weight: 16590.25 Da Isoelectric Point: 6.3688
>NTDB_id=852795 QYE81_RS08535 WP_301400712.1 1725377..1725826(-) (ssbA) [Staphylococcus haemolyticus strain CCSH-121]
MINRVILVGRLTKDPEYRTTPNGTDVANFTLAVNRNFKSKNGEQQADFINVVVFRNQAQNVNNYLSKGSLAGVDGRIQSR
SYENKEGQRVFVTEVVADSVQFLEPKNDNQKNNQSQQQRGQAPTGNNPFGNGMQNANGPIEITDDDLPF
MINRVILVGRLTKDPEYRTTPNGTDVANFTLAVNRNFKSKNGEQQADFINVVVFRNQAQNVNNYLSKGSLAGVDGRIQSR
SYENKEGQRVFVTEVVADSVQFLEPKNDNQKNNQSQQQRGQAPTGNNPFGNGMQNANGPIEITDDDLPF
Nucleotide
Download Length: 450 bp
>NTDB_id=852795 QYE81_RS08535 WP_301400712.1 1725377..1725826(-) (ssbA) [Staphylococcus haemolyticus strain CCSH-121]
ATGATAAACAGAGTAATTTTAGTAGGCAGATTAACGAAGGATCCGGAGTATAGAACTACTCCAAACGGAACAGATGTAGC
TAATTTCACACTTGCAGTAAACCGTAATTTCAAGAGTAAAAACGGTGAACAACAAGCAGATTTCATCAATGTAGTTGTAT
TCAGAAACCAAGCACAAAATGTAAATAATTACCTTTCTAAAGGCTCATTAGCTGGTGTAGACGGACGTATTCAATCACGT
AGCTATGAAAACAAAGAAGGCCAACGTGTATTCGTAACAGAAGTAGTAGCAGACAGTGTTCAGTTCTTAGAGCCAAAGAA
TGACAATCAAAAAAACAATCAATCACAACAACAAAGAGGACAAGCACCAACAGGCAATAACCCGTTTGGAAACGGAATGC
AAAATGCTAACGGTCCAATTGAAATCACTGATGACGATTTACCATTCTAG
ATGATAAACAGAGTAATTTTAGTAGGCAGATTAACGAAGGATCCGGAGTATAGAACTACTCCAAACGGAACAGATGTAGC
TAATTTCACACTTGCAGTAAACCGTAATTTCAAGAGTAAAAACGGTGAACAACAAGCAGATTTCATCAATGTAGTTGTAT
TCAGAAACCAAGCACAAAATGTAAATAATTACCTTTCTAAAGGCTCATTAGCTGGTGTAGACGGACGTATTCAATCACGT
AGCTATGAAAACAAAGAAGGCCAACGTGTATTCGTAACAGAAGTAGTAGCAGACAGTGTTCAGTTCTTAGAGCCAAAGAA
TGACAATCAAAAAAACAATCAATCACAACAACAAAGAGGACAAGCACCAACAGGCAATAACCCGTTTGGAAACGGAATGC
AAAATGCTAACGGTCCAATTGAAATCACTGATGACGATTTACCATTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.682 |
100 |
0.658 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
47.647 |
100 |
0.544 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
71.141 |
0.416 |
| ssbA | Streptococcus mutans UA159 |
41.611 |
100 |
0.416 |
| ssb | Neisseria gonorrhoeae MS11 |
34.302 |
100 |
0.396 |
| ssb | Neisseria meningitidis MC58 |
33.14 |
100 |
0.383 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
50.943 |
71.141 |
0.362 |