Detailed information NTG0850847

Bioinformatically predicted

Overview

• Name: comGF
• Type: Machinery gene
• Locus tag: LLUC320_RS11070
• Genome accession: NZ_CP129095
• Coordinates: 2155986..2156411 (-)
• Length: 141 a.a.
• NCBI ID: WP_014735174.1
• Uniprot ID: -
• Organism: Lactococcus cremoris strain UC320
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
ICE	2151123..2159353	2155986..2156411	within	0

Gene organization within MGE regions

Location: 2151123..2159353

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LLUC320_RS11045 (LLUC320_11105)	-	2152589..2153398 (-)	810	WP_011677177.1	metal ABC transporter permease	-
LLUC320_RS11050 (LLUC320_11110)	-	2153391..2154128 (-)	738	WP_011677178.1	metal ABC transporter ATP-binding protein	-
LLUC320_RS11055 (LLUC320_11115)	-	2154307..2155149 (-)	843	WP_011677179.1	metal ABC transporter solute-binding protein, Zn/Mn family	-
LLUC320_RS11060 (LLUC320_11120)	-	2155146..2155583 (-)	438	WP_011677180.1	zinc-dependent MarR family transcriptional regulator	-
LLUC320_RS11065 (LLUC320_11125)	comGG	2155663..2155890 (-)	228	WP_228764408.1	competence protein ComGG	Machinery gene
LLUC320_RS11070 (LLUC320_11130)	comGF	2155986..2156411 (-)	426	WP_014735174.1	competence type IV pilus minor pilin ComGF	Machinery gene
LLUC320_RS11075 (LLUC320_11135)	comGE	2156395..2156631 (-)	237	WP_014573335.1	competence type IV pilus minor pilin ComGE	Machinery gene
LLUC320_RS11080 (LLUC320_11140)	comGD	2156663..2156851 (-)	189	WP_014573336.1	hypothetical protein	Machinery gene
LLUC320_RS11085 (LLUC320_11145)	comGC	2157053..2157430 (-)	378	Protein_2156	competence type IV pilus major pilin ComGC	-
LLUC320_RS11090 (LLUC320_11150)	comGB	2157448..2158473 (-)	1026	WP_050574185.1	competence type IV pilus assembly protein ComGB	Machinery gene
LLUC320_RS11095 (LLUC320_11155)	comGA	2158373..2159353 (-)	981	WP_162494683.1	competence type IV pilus ATPase ComGA	Machinery gene

Sequence

Protein

• Length: 141 a.a.
• Molecular weight: 16210.78 Da
• Isoelectric Point: 8.4549

>NTDB_id=850847 LLUC320_RS11070 WP_014735174.1 2155986..2156411(-) (comGF) [Lactococcus cremoris strain UC320]
MKLKIRAFTLLECLVALLAISGSVLVISGLTRMIEEQMKISQNDSRKDWQIFCEQMRSELSGAKLDNVNQNFLYVTKDKK
LRFGLVGDDFRKSDDKGQGYQPMLYDLKGAKIQAEENLIKITIDFDNGGERVFIYRFTDTK

Nucleotide

• Length: 426 bp

>NTDB_id=850847 LLUC320_RS11070 WP_014735174.1 2155986..2156411(-) (comGF) [Lactococcus cremoris strain UC320]
TTGAAGCTCAAAATTAGGGCATTTACTTTACTTGAATGTCTCGTAGCACTTTTGGCAATTTCTGGTTCAGTGCTAGTCAT
CTCAGGGCTGACTAGAATGATTGAAGAACAGATGAAAATAAGCCAGAATGATAGTAGGAAAGATTGGCAAATATTTTGTG
AACAAATGCGTTCAGAACTCTCCGGAGCAAAATTAGACAATGTGAATCAAAATTTTTTGTATGTGACCAAAGATAAGAAG
TTACGGTTCGGATTAGTAGGGGATGATTTTCGTAAAAGTGATGATAAAGGGCAAGGATACCAACCGATGCTTTATGATTT
AAAAGGAGCAAAAATTCAGGCAGAAGAAAATTTGATAAAAATAACAATTGATTTTGATAATGGAGGTGAGCGAGTATTTA
TTTATCGATTTACTGATACAAAGTAA

Domains

Predicted by InterproScan.

• Putative Competence protein ComGF (ComGF) (38-130)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGF	Lactococcus lactis subsp. cremoris KW2	100	100	1
comYF	Streptococcus mutans UA140	43.972	100	0.44
comYF	Streptococcus mutans UA159	43.262	100	0.433
comGF/cglF	Streptococcus mitis NCTC 12261	39.286	99.291	0.39
comGF/cglF	Streptococcus mitis SK321	39.286	99.291	0.39
comGF/cglF	Streptococcus pneumoniae Rx1	37.857	99.291	0.376
comGF/cglF	Streptococcus pneumoniae D39	37.857	99.291	0.376
comGF/cglF	Streptococcus pneumoniae R6	37.857	99.291	0.376
comGF/cglF	Streptococcus pneumoniae TIGR4	37.857	99.291	0.376