Detailed information
Overview
| Name | comGG | Type | Machinery gene |
| Locus tag | LLUC320_RS11065 | Genome accession | NZ_CP129095 |
| Coordinates | 2155663..2155890 (-) | Length | 75 a.a. |
| NCBI ID | WP_228764408.1 | Uniprot ID | - |
| Organism | Lactococcus cremoris strain UC320 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 2151123..2159353 | 2155663..2155890 | within | 0 |
Gene organization within MGE regions
Location: 2151123..2159353
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLUC320_RS11045 (LLUC320_11105) | - | 2152589..2153398 (-) | 810 | WP_011677177.1 | metal ABC transporter permease | - |
| LLUC320_RS11050 (LLUC320_11110) | - | 2153391..2154128 (-) | 738 | WP_011677178.1 | metal ABC transporter ATP-binding protein | - |
| LLUC320_RS11055 (LLUC320_11115) | - | 2154307..2155149 (-) | 843 | WP_011677179.1 | metal ABC transporter solute-binding protein, Zn/Mn family | - |
| LLUC320_RS11060 (LLUC320_11120) | - | 2155146..2155583 (-) | 438 | WP_011677180.1 | zinc-dependent MarR family transcriptional regulator | - |
| LLUC320_RS11065 (LLUC320_11125) | comGG | 2155663..2155890 (-) | 228 | WP_228764408.1 | competence protein ComGG | Machinery gene |
| LLUC320_RS11070 (LLUC320_11130) | comGF | 2155986..2156411 (-) | 426 | WP_014735174.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| LLUC320_RS11075 (LLUC320_11135) | comGE | 2156395..2156631 (-) | 237 | WP_014573335.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| LLUC320_RS11080 (LLUC320_11140) | comGD | 2156663..2156851 (-) | 189 | WP_014573336.1 | hypothetical protein | Machinery gene |
| LLUC320_RS11085 (LLUC320_11145) | comGC | 2157053..2157430 (-) | 378 | Protein_2156 | competence type IV pilus major pilin ComGC | - |
| LLUC320_RS11090 (LLUC320_11150) | comGB | 2157448..2158473 (-) | 1026 | WP_050574185.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| LLUC320_RS11095 (LLUC320_11155) | comGA | 2158373..2159353 (-) | 981 | WP_162494683.1 | competence type IV pilus ATPase ComGA | Machinery gene |
Sequence
Protein
Download Length: 75 a.a. Molecular weight: 8406.73 Da Isoelectric Point: 9.0864
>NTDB_id=850846 LLUC320_RS11065 WP_228764408.1 2155663..2155890(-) (comGG) [Lactococcus cremoris strain UC320]
MKIEKERLTAELMVSLALKKDLKTSGQLNFDCGNLTYKLLTDLSADSTSGGQTVSNKTYCFDVRLKDGRIYQIVK
MKIEKERLTAELMVSLALKKDLKTSGQLNFDCGNLTYKLLTDLSADSTSGGQTVSNKTYCFDVRLKDGRIYQIVK
Nucleotide
Download Length: 228 bp
>NTDB_id=850846 LLUC320_RS11065 WP_228764408.1 2155663..2155890(-) (comGG) [Lactococcus cremoris strain UC320]
TTGAAAATAGAAAAGGAGCGACTGACAGCCGAATTAATGGTTTCATTGGCTCTTAAAAAGGATTTGAAAACGAGTGGTCA
ACTTAATTTTGATTGTGGAAATTTAACTTACAAATTACTGACAGATCTGTCAGCTGATTCAACTAGCGGTGGTCAAACTG
TTAGTAATAAAACTTATTGTTTTGATGTTCGGCTTAAGGATGGAAGAATTTATCAAATAGTAAAGTAA
TTGAAAATAGAAAAGGAGCGACTGACAGCCGAATTAATGGTTTCATTGGCTCTTAAAAAGGATTTGAAAACGAGTGGTCA
ACTTAATTTTGATTGTGGAAATTTAACTTACAAATTACTGACAGATCTGTCAGCTGATTCAACTAGCGGTGGTCAAACTG
TTAGTAATAAAACTTATTGTTTTGATGTTCGGCTTAAGGATGGAAGAATTTATCAAATAGTAAAGTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGG | Lactococcus lactis subsp. cremoris KW2 |
96 |
100 |
0.96 |