NTDB

Overview

Name	clpP	Type	Regulator
Locus tag	V4U93_RS02880	Genome accession	NZ_CP144755
Coordinates	582740..583324 (-)	Length	194 a.a.
NCBI ID	WP_025016311.1	Uniprot ID	-
Organism	Latilactobacillus sakei subsp. sakei strain DCF0720
Function	degradation of ComX (predicted from homology) Competence regulation

Genomic Context

Location: 577740..588324

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
V4U93_RS02850 (V4U93_02850)	-	577805..578341 (+)	537	WP_016264747.1	DUF308 domain-containing protein	-
V4U93_RS02855 (V4U93_02855)	rapZ	578467..579351 (+)	885	WP_011374234.1	RNase adapter RapZ	-
V4U93_RS02860 (V4U93_02860)	-	579348..580382 (+)	1035	WP_035146453.1	YvcK family protein	-
V4U93_RS02865 (V4U93_02865)	whiA	580385..581329 (+)	945	WP_011374236.1	DNA-binding protein WhiA	-
V4U93_RS02870 (V4U93_02870)	-	581421..581876 (+)	456	WP_035146456.1	MarR family transcriptional regulator	-
V4U93_RS02875 (V4U93_02875)	-	581991..582515 (-)	525	WP_035146459.1	DsbA family protein	-
V4U93_RS02880 (V4U93_02880)	clpP	582740..583324 (-)	585	WP_025016311.1	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	Regulator
V4U93_RS02885 (V4U93_02885)	-	583868..584449 (-)	582	WP_025016310.1	glycoside hydrolase family 73 protein	-
V4U93_RS02890 (V4U93_02890)	-	584664..585623 (+)	960	WP_025016309.1	nucleoside hydrolase	-
V4U93_RS02895 (V4U93_02895)	-	585813..587762 (+)	1950	WP_338453833.1	adhesive domain-containing protein	-

Sequence

Protein

Download Length: 194 a.a. Molecular weight: 21244.27 Da Isoelectric Point: 4.6805

                                >NTDB_id=847701 V4U93_RS02880 WP_025016311.1 582740..583324(-) (clpP) [Latilactobacillus sakei subsp. sakei strain DCF0720]

MLVPTVIEQTSRGERAYDIYSRLLKDRIIMLSGEVNDQMANTIIAQLLFLDAQDSDKDISIYINSPGGSVTAGLAIMDTM

NFIKSDVQTIAMGMAASMASVLLSAGTKGKRFALPNSTVLIHQPLGGAQGQQTEIEIAAREILKTRKRLNQILADNSGQS

FEKLQADTDRDNYMTAQEAKDYGLIDDIMVNQPK

Nucleotide

Download Length: 585 bp

                                >NTDB_id=847701 V4U93_RS02880 WP_025016311.1 582740..583324(-) (clpP) [Latilactobacillus sakei subsp. sakei strain DCF0720]

ATGTTAGTACCGACAGTTATCGAACAAACATCTCGTGGCGAACGCGCCTACGATATTTACTCTCGTTTACTAAAAGACCG

GATCATCATGTTATCTGGTGAAGTGAACGACCAAATGGCTAACACAATCATTGCGCAATTACTATTCTTGGATGCGCAAG

ATTCAGATAAGGATATTTCAATCTACATCAACTCACCTGGTGGTTCTGTGACAGCCGGTTTGGCAATCATGGATACAATG

AACTTCATTAAATCTGATGTTCAAACAATCGCTATGGGCATGGCTGCTTCAATGGCCAGCGTTTTACTTTCAGCTGGGAC

AAAAGGCAAACGTTTTGCATTGCCTAACTCAACAGTCTTAATTCACCAACCTTTAGGCGGTGCACAAGGCCAACAAACTG

AAATTGAAATCGCTGCTCGCGAAATTTTGAAGACTCGGAAACGTTTGAACCAAATCTTGGCAGACAATTCTGGTCAAAGC

TTCGAAAAATTACAAGCAGACACTGATCGTGATAACTACATGACAGCCCAAGAAGCAAAAGATTACGGTTTGATTGACGA

CATTATGGTTAACCAACCAAAATAG

Domains

Predicted by InterProScan.

Clp protease (CLP_protease)

(12-191)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
clpP	Lactococcus lactis subsp. cremoris KW2	71.354	98.969	0.706
clpP	Lactococcus lactis subsp. lactis strain DGCC12653	69.271	98.969	0.686
clpP	Streptococcus pneumoniae D39	68.229	98.969	0.675
clpP	Streptococcus pneumoniae R6	68.229	98.969	0.675
clpP	Streptococcus pneumoniae TIGR4	68.229	98.969	0.675
clpP	Streptococcus thermophilus LMD-9	68.229	98.969	0.675
clpP	Streptococcus thermophilus LMG 18311	68.229	98.969	0.675
clpP	Streptococcus pneumoniae Rx1	68.229	98.969	0.675
clpP	Bacillus subtilis subsp. subtilis str. 168	66.842	97.938	0.655
clpP	Streptococcus mutans UA159	65.625	98.969	0.649
clpP	Streptococcus pyogenes JRS4	64.583	98.969	0.639
clpP	Streptococcus pyogenes MGAS315	64.583	98.969	0.639
clpP	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	64.021	97.423	0.624

Detailed information NTG0847701