Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | K5606_RS09805 | Genome accession | NZ_AP024318 |
| Coordinates | 2002639..2003109 (-) | Length | 156 a.a. |
| NCBI ID | WP_017466775.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain S36 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1972420..2024841 | 2002639..2003109 | within | 0 |
Gene organization within MGE regions
Location: 1972420..2024841
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| K5606_RS09585 (S36TP_17990) | scn | 1972420..1972770 (-) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| K5606_RS09590 (S36TP_18000) | - | 1973455..1973904 (+) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| K5606_RS09595 (S36TP_18010) | - | 1973999..1974337 (-) | 339 | Protein_1868 | SH3 domain-containing protein | - |
| K5606_RS09600 (S36TP_18020) | sak | 1974984..1975475 (-) | 492 | WP_000919350.1 | staphylokinase | - |
| K5606_RS09605 (S36TP_18030) | - | 1975666..1976421 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| K5606_RS09610 (S36TP_18040) | - | 1976433..1976687 (-) | 255 | WP_000611512.1 | phage holin | - |
| K5606_RS09615 | - | 1976739..1976846 (+) | 108 | WP_001791821.1 | hypothetical protein | - |
| K5606_RS09620 (S36TP_18050) | pepG1 | 1976899..1977033 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| K5606_RS09625 (S36TP_18060) | - | 1977225..1977521 (-) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| K5606_RS09630 (S36TP_18070) | - | 1977579..1977866 (-) | 288 | WP_001040261.1 | hypothetical protein | - |
| K5606_RS09635 (S36TP_18080) | - | 1977913..1978065 (-) | 153 | WP_001153681.1 | hypothetical protein | - |
| K5606_RS09640 (S36TP_18090) | - | 1978055..1981840 (-) | 3786 | WP_000582165.1 | phage tail spike protein | - |
| K5606_RS09645 (S36TP_18100) | - | 1981856..1983340 (-) | 1485 | WP_000567408.1 | phage distal tail protein | - |
| K5606_RS09650 (S36TP_18110) | - | 1983337..1987866 (-) | 4530 | WP_103146220.1 | phage tail tape measure protein | - |
| K5606_RS09655 (S36TP_18120) | gpGT | 1987923..1988060 (-) | 138 | WP_180992418.1 | phage tail assembly chaperone GT | - |
| K5606_RS09660 (S36TP_18130) | gpG | 1988111..1988461 (-) | 351 | WP_001096355.1 | phage tail assembly chaperone G | - |
| K5606_RS09665 | - | 1988511..1988741 (-) | 231 | Protein_1882 | Ig-like domain-containing protein | - |
| K5606_RS09670 (S36TP_18150) | - | 1988777..1989421 (-) | 645 | WP_000268740.1 | major tail protein | - |
| K5606_RS09675 (S36TP_18160) | - | 1989422..1989829 (-) | 408 | WP_000565498.1 | hypothetical protein | - |
| K5606_RS09680 (S36TP_18170) | - | 1989826..1990230 (-) | 405 | WP_000114226.1 | HK97 gp10 family phage protein | - |
| K5606_RS09685 (S36TP_18180) | - | 1990227..1990589 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| K5606_RS09690 (S36TP_18190) | - | 1990573..1990857 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| K5606_RS09695 (S36TP_18200) | - | 1990847..1991131 (-) | 285 | WP_000238236.1 | hypothetical protein | - |
| K5606_RS09700 (S36TP_18210) | - | 1991151..1992296 (-) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| K5606_RS09705 (S36TP_18220) | - | 1992320..1993057 (-) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| K5606_RS09710 (S36TP_18230) | - | 1993041..1994228 (-) | 1188 | WP_000025274.1 | phage portal protein | - |
| K5606_RS09715 (S36TP_18240) | - | 1994244..1995905 (-) | 1662 | WP_103146218.1 | terminase large subunit | - |
| K5606_RS09720 (S36TP_18250) | - | 1995902..1996246 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| K5606_RS09725 (S36TP_18260) | - | 1996376..1996675 (-) | 300 | WP_000988330.1 | HNH endonuclease | - |
| K5606_RS09730 (S36TP_18270) | - | 1996907..1997323 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| K5606_RS09735 (S36TP_18280) | - | 1997351..1997551 (-) | 201 | WP_103146217.1 | DUF1514 family protein | - |
| K5606_RS09740 (S36TP_18290) | - | 1997551..1998201 (-) | 651 | WP_001005262.1 | hypothetical protein | - |
| K5606_RS09745 (S36TP_18310) | rinB | 1998360..1998509 (-) | 150 | WP_070030217.1 | transcriptional activator RinB | - |
| K5606_RS09750 (S36TP_18320) | - | 1998522..1998980 (-) | 459 | WP_031768021.1 | hypothetical protein | - |
| K5606_RS09755 (S36TP_18330) | - | 1998973..1999125 (-) | 153 | WP_031768020.1 | DUF1381 domain-containing protein | - |
| K5606_RS09760 (S36TP_18340) | - | 1999162..1999671 (-) | 510 | WP_031866561.1 | dUTP diphosphatase | - |
| K5606_RS09765 (S36TP_18350) | - | 1999664..1999846 (-) | 183 | WP_000028421.1 | hypothetical protein | - |
| K5606_RS09770 (S36TP_18360) | - | 1999836..2000087 (-) | 252 | WP_001836226.1 | DUF1024 family protein | - |
| K5606_RS09775 (S36TP_18370) | - | 2000080..2000451 (-) | 372 | WP_001557190.1 | hypothetical protein | - |
| K5606_RS09780 (S36TP_18380) | - | 2000460..2000702 (-) | 243 | WP_000131379.1 | phi PVL orf 51-like protein | - |
| K5606_RS09785 (S36TP_18390) | - | 2000706..2001074 (-) | 369 | WP_000101270.1 | SA1788 family PVL leukocidin-associated protein | - |
| K5606_RS09790 (S36TP_18400) | - | 2001087..2001491 (-) | 405 | WP_103146216.1 | RusA family crossover junction endodeoxyribonuclease | - |
| K5606_RS09795 (S36TP_18410) | - | 2001500..2001718 (-) | 219 | WP_053819389.1 | hypothetical protein | - |
| K5606_RS09800 (S36TP_18420) | - | 2001725..2002609 (-) | 885 | WP_103146215.1 | DnaD domain protein | - |
| K5606_RS09805 (S36TP_18430) | ssbA | 2002639..2003109 (-) | 471 | WP_017466775.1 | single-stranded DNA-binding protein | Machinery gene |
| K5606_RS09810 (S36TP_18440) | - | 2003110..2003727 (-) | 618 | WP_224211742.1 | MBL fold metallo-hydrolase | - |
| K5606_RS09815 (S36TP_18450) | - | 2003808..2004728 (-) | 921 | WP_103146214.1 | recombinase RecT | - |
| K5606_RS09820 (S36TP_18460) | - | 2004730..2006673 (-) | 1944 | WP_103146213.1 | AAA family ATPase | - |
| K5606_RS09825 (S36TP_18470) | - | 2006682..2006945 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| K5606_RS09830 (S36TP_18480) | - | 2006954..2007214 (-) | 261 | WP_000291488.1 | DUF1108 family protein | - |
| K5606_RS09835 (S36TP_18490) | - | 2007307..2007468 (-) | 162 | WP_221063058.1 | DUF1270 family protein | - |
| K5606_RS09840 (S36TP_18500) | - | 2007465..2007785 (-) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| K5606_RS09845 (S36TP_18510) | - | 2007844..2008476 (+) | 633 | WP_000275058.1 | hypothetical protein | - |
| K5606_RS09850 (S36TP_18520) | - | 2008491..2008631 (-) | 141 | WP_000939496.1 | hypothetical protein | - |
| K5606_RS09855 (S36TP_18530) | - | 2008662..2008859 (-) | 198 | WP_001148861.1 | hypothetical protein | - |
| K5606_RS09860 (S36TP_18540) | - | 2008875..2009630 (-) | 756 | WP_001148341.1 | phage antirepressor KilAC domain-containing protein | - |
| K5606_RS09865 (S36TP_18550) | - | 2009687..2010226 (+) | 540 | WP_000351243.1 | hypothetical protein | - |
| K5606_RS09870 | - | 2010250..2010510 (-) | 261 | Protein_1923 | transcriptional regulator | - |
| K5606_RS09875 (S36TP_18560) | - | 2010524..2010766 (-) | 243 | WP_000639927.1 | DUF739 family protein | - |
| K5606_RS09880 (S36TP_18570) | - | 2010930..2011646 (+) | 717 | WP_001083967.1 | LexA family transcriptional regulator | - |
| K5606_RS09885 (S36TP_18580) | - | 2011658..2012515 (+) | 858 | WP_000804507.1 | HIRAN domain-containing protein | - |
| K5606_RS09890 (S36TP_18590) | - | 2012560..2012742 (+) | 183 | WP_000705248.1 | hypothetical protein | - |
| K5606_RS09895 (S36TP_18600) | - | 2012842..2013306 (+) | 465 | WP_000825947.1 | hypothetical protein | - |
| K5606_RS09900 (S36TP_18610) | - | 2013365..2014402 (+) | 1038 | WP_000857191.1 | site-specific integrase | - |
| K5606_RS09905 (S36TP_18620) | sph | 2014459..2015283 (+) | 825 | Protein_1930 | sphingomyelin phosphodiesterase | - |
| K5606_RS09910 (S36TP_18630) | - | 2015545..2016561 (-) | 1017 | WP_000595612.1 | leukocidin/hemolysin toxin family protein | - |
| K5606_RS09915 (S36TP_18640) | - | 2016583..2017638 (-) | 1056 | WP_000791397.1 | leukocidin family pore-forming toxin | - |
| K5606_RS09920 (S36TP_18650) | - | 2018070..2019293 (+) | 1224 | WP_000206618.1 | ArgE/DapE family deacylase | - |
| K5606_RS09925 (S36TP_18660) | - | 2019676..2020983 (+) | 1308 | WP_001045074.1 | TrkH family potassium uptake protein | - |
| K5606_RS09930 (S36TP_18670) | - | 2021522..2022148 (-) | 627 | WP_000216896.1 | hypothetical protein | - |
| K5606_RS09935 (S36TP_18680) | - | 2022145..2022324 (-) | 180 | WP_000201398.1 | hypothetical protein | - |
| K5606_RS09940 (S36TP_18690) | groL | 2022865..2024481 (-) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| K5606_RS09945 (S36TP_18700) | groES | 2024557..2024841 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17730.57 Da Isoelectric Point: 4.7821
>NTDB_id=84768 K5606_RS09805 WP_017466775.1 2002639..2003109(-) (ssbA) [Staphylococcus aureus strain S36]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNTNDNQQDLYQQQAQQSRGQSQYPYNKPVKDNPFANANDPIEIDDDDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNTNDNQQDLYQQQAQQSRGQSQYPYNKPVKDNPFANANDPIEIDDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=84768 K5606_RS09805 WP_017466775.1 2002639..2003109(-) (ssbA) [Staphylococcus aureus strain S36]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACAAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CACAAATGATAATCAACAAGATTTATACCAACAACAAGCGCAACAATCACGTGGACAGTCTCAATATCCATATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGATCCTATTGAAATAGATGACGATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACAAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CACAAATGATAATCAACAAGATTTATACCAACAACAAGCGCAACAATCACGTGGACAGTCTCAATATCCATATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGATCCTATTGAAATAGATGACGATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.941 |
100 |
0.577 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Neisseria meningitidis MC58 |
34.682 |
100 |
0.385 |
| ssb | Neisseria gonorrhoeae MS11 |
34.682 |
100 |
0.385 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |