Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   K5606_RS09805 Genome accession   NZ_AP024318
Coordinates   2002639..2003109 (-) Length   156 a.a.
NCBI ID   WP_017466775.1    Uniprot ID   -
Organism   Staphylococcus aureus strain S36     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1972420..2024841 2002639..2003109 within 0


Gene organization within MGE regions


Location: 1972420..2024841
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K5606_RS09585 (S36TP_17990) scn 1972420..1972770 (-) 351 WP_000702263.1 complement inhibitor SCIN-A -
  K5606_RS09590 (S36TP_18000) - 1973455..1973904 (+) 450 WP_000727649.1 chemotaxis-inhibiting protein CHIPS -
  K5606_RS09595 (S36TP_18010) - 1973999..1974337 (-) 339 Protein_1868 SH3 domain-containing protein -
  K5606_RS09600 (S36TP_18020) sak 1974984..1975475 (-) 492 WP_000919350.1 staphylokinase -
  K5606_RS09605 (S36TP_18030) - 1975666..1976421 (-) 756 WP_000861038.1 CHAP domain-containing protein -
  K5606_RS09610 (S36TP_18040) - 1976433..1976687 (-) 255 WP_000611512.1 phage holin -
  K5606_RS09615 - 1976739..1976846 (+) 108 WP_001791821.1 hypothetical protein -
  K5606_RS09620 (S36TP_18050) pepG1 1976899..1977033 (-) 135 WP_000226108.1 type I toxin-antitoxin system toxin PepG1 -
  K5606_RS09625 (S36TP_18060) - 1977225..1977521 (-) 297 WP_000539688.1 DUF2951 domain-containing protein -
  K5606_RS09630 (S36TP_18070) - 1977579..1977866 (-) 288 WP_001040261.1 hypothetical protein -
  K5606_RS09635 (S36TP_18080) - 1977913..1978065 (-) 153 WP_001153681.1 hypothetical protein -
  K5606_RS09640 (S36TP_18090) - 1978055..1981840 (-) 3786 WP_000582165.1 phage tail spike protein -
  K5606_RS09645 (S36TP_18100) - 1981856..1983340 (-) 1485 WP_000567408.1 phage distal tail protein -
  K5606_RS09650 (S36TP_18110) - 1983337..1987866 (-) 4530 WP_103146220.1 phage tail tape measure protein -
  K5606_RS09655 (S36TP_18120) gpGT 1987923..1988060 (-) 138 WP_180992418.1 phage tail assembly chaperone GT -
  K5606_RS09660 (S36TP_18130) gpG 1988111..1988461 (-) 351 WP_001096355.1 phage tail assembly chaperone G -
  K5606_RS09665 - 1988511..1988741 (-) 231 Protein_1882 Ig-like domain-containing protein -
  K5606_RS09670 (S36TP_18150) - 1988777..1989421 (-) 645 WP_000268740.1 major tail protein -
  K5606_RS09675 (S36TP_18160) - 1989422..1989829 (-) 408 WP_000565498.1 hypothetical protein -
  K5606_RS09680 (S36TP_18170) - 1989826..1990230 (-) 405 WP_000114226.1 HK97 gp10 family phage protein -
  K5606_RS09685 (S36TP_18180) - 1990227..1990589 (-) 363 WP_000755150.1 head-tail adaptor protein -
  K5606_RS09690 (S36TP_18190) - 1990573..1990857 (-) 285 WP_000150936.1 phage head-tail adapter protein -
  K5606_RS09695 (S36TP_18200) - 1990847..1991131 (-) 285 WP_000238236.1 hypothetical protein -
  K5606_RS09700 (S36TP_18210) - 1991151..1992296 (-) 1146 WP_000154559.1 phage major capsid protein -
  K5606_RS09705 (S36TP_18220) - 1992320..1993057 (-) 738 WP_000642728.1 head maturation protease, ClpP-related -
  K5606_RS09710 (S36TP_18230) - 1993041..1994228 (-) 1188 WP_000025274.1 phage portal protein -
  K5606_RS09715 (S36TP_18240) - 1994244..1995905 (-) 1662 WP_103146218.1 terminase large subunit -
  K5606_RS09720 (S36TP_18250) - 1995902..1996246 (-) 345 WP_000402904.1 hypothetical protein -
  K5606_RS09725 (S36TP_18260) - 1996376..1996675 (-) 300 WP_000988330.1 HNH endonuclease -
  K5606_RS09730 (S36TP_18270) - 1996907..1997323 (-) 417 WP_000590122.1 hypothetical protein -
  K5606_RS09735 (S36TP_18280) - 1997351..1997551 (-) 201 WP_103146217.1 DUF1514 family protein -
  K5606_RS09740 (S36TP_18290) - 1997551..1998201 (-) 651 WP_001005262.1 hypothetical protein -
  K5606_RS09745 (S36TP_18310) rinB 1998360..1998509 (-) 150 WP_070030217.1 transcriptional activator RinB -
  K5606_RS09750 (S36TP_18320) - 1998522..1998980 (-) 459 WP_031768021.1 hypothetical protein -
  K5606_RS09755 (S36TP_18330) - 1998973..1999125 (-) 153 WP_031768020.1 DUF1381 domain-containing protein -
  K5606_RS09760 (S36TP_18340) - 1999162..1999671 (-) 510 WP_031866561.1 dUTP diphosphatase -
  K5606_RS09765 (S36TP_18350) - 1999664..1999846 (-) 183 WP_000028421.1 hypothetical protein -
  K5606_RS09770 (S36TP_18360) - 1999836..2000087 (-) 252 WP_001836226.1 DUF1024 family protein -
  K5606_RS09775 (S36TP_18370) - 2000080..2000451 (-) 372 WP_001557190.1 hypothetical protein -
  K5606_RS09780 (S36TP_18380) - 2000460..2000702 (-) 243 WP_000131379.1 phi PVL orf 51-like protein -
  K5606_RS09785 (S36TP_18390) - 2000706..2001074 (-) 369 WP_000101270.1 SA1788 family PVL leukocidin-associated protein -
  K5606_RS09790 (S36TP_18400) - 2001087..2001491 (-) 405 WP_103146216.1 RusA family crossover junction endodeoxyribonuclease -
  K5606_RS09795 (S36TP_18410) - 2001500..2001718 (-) 219 WP_053819389.1 hypothetical protein -
  K5606_RS09800 (S36TP_18420) - 2001725..2002609 (-) 885 WP_103146215.1 DnaD domain protein -
  K5606_RS09805 (S36TP_18430) ssbA 2002639..2003109 (-) 471 WP_017466775.1 single-stranded DNA-binding protein Machinery gene
  K5606_RS09810 (S36TP_18440) - 2003110..2003727 (-) 618 WP_224211742.1 MBL fold metallo-hydrolase -
  K5606_RS09815 (S36TP_18450) - 2003808..2004728 (-) 921 WP_103146214.1 recombinase RecT -
  K5606_RS09820 (S36TP_18460) - 2004730..2006673 (-) 1944 WP_103146213.1 AAA family ATPase -
  K5606_RS09825 (S36TP_18470) - 2006682..2006945 (-) 264 WP_001205732.1 hypothetical protein -
  K5606_RS09830 (S36TP_18480) - 2006954..2007214 (-) 261 WP_000291488.1 DUF1108 family protein -
  K5606_RS09835 (S36TP_18490) - 2007307..2007468 (-) 162 WP_221063058.1 DUF1270 family protein -
  K5606_RS09840 (S36TP_18500) - 2007465..2007785 (-) 321 WP_001120197.1 DUF771 domain-containing protein -
  K5606_RS09845 (S36TP_18510) - 2007844..2008476 (+) 633 WP_000275058.1 hypothetical protein -
  K5606_RS09850 (S36TP_18520) - 2008491..2008631 (-) 141 WP_000939496.1 hypothetical protein -
  K5606_RS09855 (S36TP_18530) - 2008662..2008859 (-) 198 WP_001148861.1 hypothetical protein -
  K5606_RS09860 (S36TP_18540) - 2008875..2009630 (-) 756 WP_001148341.1 phage antirepressor KilAC domain-containing protein -
  K5606_RS09865 (S36TP_18550) - 2009687..2010226 (+) 540 WP_000351243.1 hypothetical protein -
  K5606_RS09870 - 2010250..2010510 (-) 261 Protein_1923 transcriptional regulator -
  K5606_RS09875 (S36TP_18560) - 2010524..2010766 (-) 243 WP_000639927.1 DUF739 family protein -
  K5606_RS09880 (S36TP_18570) - 2010930..2011646 (+) 717 WP_001083967.1 LexA family transcriptional regulator -
  K5606_RS09885 (S36TP_18580) - 2011658..2012515 (+) 858 WP_000804507.1 HIRAN domain-containing protein -
  K5606_RS09890 (S36TP_18590) - 2012560..2012742 (+) 183 WP_000705248.1 hypothetical protein -
  K5606_RS09895 (S36TP_18600) - 2012842..2013306 (+) 465 WP_000825947.1 hypothetical protein -
  K5606_RS09900 (S36TP_18610) - 2013365..2014402 (+) 1038 WP_000857191.1 site-specific integrase -
  K5606_RS09905 (S36TP_18620) sph 2014459..2015283 (+) 825 Protein_1930 sphingomyelin phosphodiesterase -
  K5606_RS09910 (S36TP_18630) - 2015545..2016561 (-) 1017 WP_000595612.1 leukocidin/hemolysin toxin family protein -
  K5606_RS09915 (S36TP_18640) - 2016583..2017638 (-) 1056 WP_000791397.1 leukocidin family pore-forming toxin -
  K5606_RS09920 (S36TP_18650) - 2018070..2019293 (+) 1224 WP_000206618.1 ArgE/DapE family deacylase -
  K5606_RS09925 (S36TP_18660) - 2019676..2020983 (+) 1308 WP_001045074.1 TrkH family potassium uptake protein -
  K5606_RS09930 (S36TP_18670) - 2021522..2022148 (-) 627 WP_000216896.1 hypothetical protein -
  K5606_RS09935 (S36TP_18680) - 2022145..2022324 (-) 180 WP_000201398.1 hypothetical protein -
  K5606_RS09940 (S36TP_18690) groL 2022865..2024481 (-) 1617 WP_000240642.1 chaperonin GroEL -
  K5606_RS09945 (S36TP_18700) groES 2024557..2024841 (-) 285 WP_000917289.1 co-chaperone GroES -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17730.57 Da        Isoelectric Point: 4.7821

>NTDB_id=84768 K5606_RS09805 WP_017466775.1 2002639..2003109(-) (ssbA) [Staphylococcus aureus strain S36]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNTNDNQQDLYQQQAQQSRGQSQYPYNKPVKDNPFANANDPIEIDDDDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=84768 K5606_RS09805 WP_017466775.1 2002639..2003109(-) (ssbA) [Staphylococcus aureus strain S36]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACAAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CACAAATGATAATCAACAAGATTTATACCAACAACAAGCGCAACAATCACGTGGACAGTCTCAATATCCATATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGATCCTATTGAAATAGATGACGATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.932

100

0.635

  ssb Latilactobacillus sakei subsp. sakei 23K

52.941

100

0.577

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Neisseria meningitidis MC58

34.682

100

0.385

  ssb Neisseria gonorrhoeae MS11

34.682

100

0.385

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365


Multiple sequence alignment