Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | QSV38_RS02125 | Genome accession | NZ_CP128410 |
| Coordinates | 428081..428260 (-) | Length | 59 a.a. |
| NCBI ID | WP_289649012.1 | Uniprot ID | - |
| Organism | Streptococcus parasuis strain 7500 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 428081..484797 | 428081..428260 | within | 0 |
Gene organization within MGE regions
Location: 428081..484797
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QSV38_RS02125 (QSV38_02125) | prx | 428081..428260 (-) | 180 | WP_289649012.1 | Paratox | Regulator |
| QSV38_RS02130 (QSV38_02130) | - | 428380..428733 (+) | 354 | WP_289649013.1 | hypothetical protein | - |
| QSV38_RS02135 (QSV38_02135) | - | 428757..429308 (+) | 552 | WP_289649014.1 | elongation factor G | - |
| QSV38_RS02140 (QSV38_02140) | - | 429430..430200 (-) | 771 | WP_289649015.1 | N-acetylmuramoyl-L-alanine amidase | - |
| QSV38_RS02145 (QSV38_02145) | - | 430321..430560 (-) | 240 | WP_289649016.1 | phage holin | - |
| QSV38_RS02150 (QSV38_02150) | - | 430561..430839 (-) | 279 | WP_289649017.1 | hypothetical protein | - |
| QSV38_RS02155 (QSV38_02155) | - | 430842..430997 (-) | 156 | WP_289649018.1 | hypothetical protein | - |
| QSV38_RS02160 (QSV38_02160) | - | 431038..431433 (-) | 396 | WP_289649019.1 | DUF1366 domain-containing protein | - |
| QSV38_RS02165 (QSV38_02165) | - | 431443..433572 (-) | 2130 | WP_289649020.1 | hypothetical protein | - |
| QSV38_RS02170 (QSV38_02170) | - | 433532..433711 (-) | 180 | WP_289649021.1 | hypothetical protein | - |
| QSV38_RS02175 (QSV38_02175) | - | 433723..434841 (-) | 1119 | WP_289649022.1 | hypothetical protein | - |
| QSV38_RS02180 (QSV38_02180) | - | 434859..436589 (-) | 1731 | WP_289649023.1 | hypothetical protein | - |
| QSV38_RS02185 (QSV38_02185) | - | 436589..438145 (-) | 1557 | WP_289649024.1 | distal tail protein Dit | - |
| QSV38_RS02190 (QSV38_02190) | - | 438142..441816 (-) | 3675 | WP_289649025.1 | tape measure protein | - |
| QSV38_RS02195 (QSV38_02195) | - | 442018..442380 (-) | 363 | WP_289649026.1 | phage tail tube assembly chaperone | - |
| QSV38_RS02200 (QSV38_02200) | - | 442442..443053 (-) | 612 | WP_289649027.1 | phage tail protein | - |
| QSV38_RS02205 (QSV38_02205) | - | 443070..443444 (-) | 375 | WP_289649028.1 | DUF806 family protein | - |
| QSV38_RS02210 (QSV38_02210) | - | 443448..443855 (-) | 408 | WP_289649029.1 | HK97 gp10 family phage protein | - |
| QSV38_RS02215 (QSV38_02215) | - | 443866..444213 (-) | 348 | WP_289649030.1 | phage head closure protein | - |
| QSV38_RS02220 (QSV38_02220) | - | 444188..444532 (-) | 345 | WP_289649031.1 | head-tail connector protein | - |
| QSV38_RS02225 (QSV38_02225) | - | 444546..445733 (-) | 1188 | WP_289649032.1 | phage major capsid protein | - |
| QSV38_RS02230 (QSV38_02230) | - | 445749..446435 (-) | 687 | WP_289649034.1 | head maturation protease, ClpP-related | - |
| QSV38_RS02235 (QSV38_02235) | - | 446442..447560 (-) | 1119 | WP_289649035.1 | phage portal protein | - |
| QSV38_RS02240 (QSV38_02240) | - | 447606..447749 (-) | 144 | WP_289649036.1 | hypothetical protein | - |
| QSV38_RS02245 (QSV38_02245) | - | 447746..448030 (-) | 285 | WP_289649037.1 | hypothetical protein | - |
| QSV38_RS02250 (QSV38_02250) | - | 448032..448283 (-) | 252 | WP_289649038.1 | hypothetical protein | - |
| QSV38_RS02255 (QSV38_02255) | - | 448280..448471 (-) | 192 | WP_354318698.1 | DUF1056 family protein | - |
| QSV38_RS02260 (QSV38_02260) | - | 448474..450348 (-) | 1875 | WP_289649039.1 | terminase TerL endonuclease subunit | - |
| QSV38_RS02265 (QSV38_02265) | - | 450360..450818 (-) | 459 | WP_289649040.1 | phage terminase small subunit P27 family | - |
| QSV38_RS02270 (QSV38_02270) | - | 451014..451514 (-) | 501 | WP_289649041.1 | HNH endonuclease | - |
| QSV38_RS02275 (QSV38_02275) | - | 451524..451787 (-) | 264 | WP_289649042.1 | hypothetical protein | - |
| QSV38_RS02280 (QSV38_02280) | - | 451888..452745 (-) | 858 | WP_289649043.1 | DNA adenine methylase | - |
| QSV38_RS02285 (QSV38_02285) | - | 453460..453894 (-) | 435 | WP_289649045.1 | DUF1492 domain-containing protein | - |
| QSV38_RS02290 (QSV38_02290) | - | 453968..454444 (-) | 477 | WP_289649046.1 | helix-turn-helix transcriptional regulator | - |
| QSV38_RS02295 (QSV38_02295) | - | 454441..454647 (-) | 207 | WP_289649047.1 | hypothetical protein | - |
| QSV38_RS02300 (QSV38_02300) | - | 454640..454912 (-) | 273 | WP_289649048.1 | hypothetical protein | - |
| QSV38_RS02305 (QSV38_02305) | - | 454914..455315 (-) | 402 | WP_289649049.1 | YopX family protein | - |
| QSV38_RS02310 (QSV38_02310) | - | 455400..455966 (-) | 567 | WP_289649050.1 | DUF1642 domain-containing protein | - |
| QSV38_RS02315 (QSV38_02315) | - | 455959..456291 (-) | 333 | WP_289649051.1 | hypothetical protein | - |
| QSV38_RS02320 (QSV38_02320) | - | 456288..456617 (-) | 330 | WP_289649052.1 | hypothetical protein | - |
| QSV38_RS02325 (QSV38_02325) | - | 456607..456852 (-) | 246 | WP_289649053.1 | hypothetical protein | - |
| QSV38_RS02330 (QSV38_02330) | - | 456895..457644 (-) | 750 | WP_289649054.1 | site-specific DNA-methyltransferase | - |
| QSV38_RS02335 (QSV38_02335) | - | 457634..457924 (-) | 291 | WP_289649055.1 | DUF3310 domain-containing protein | - |
| QSV38_RS02340 (QSV38_02340) | - | 457937..458254 (-) | 318 | WP_289649056.1 | VRR-NUC domain-containing protein | - |
| QSV38_RS02345 (QSV38_02345) | - | 458506..460011 (-) | 1506 | WP_354318834.1 | phage/plasmid primase, P4 family | - |
| QSV38_RS02350 (QSV38_02350) | - | 460007..460819 (-) | 813 | WP_289649058.1 | bifunctional DNA primase/polymerase | - |
| QSV38_RS02355 (QSV38_02355) | - | 460823..461284 (-) | 462 | WP_289649059.1 | DUF669 domain-containing protein | - |
| QSV38_RS02360 (QSV38_02360) | - | 461307..462650 (-) | 1344 | WP_289649060.1 | DEAD/DEAH box helicase | - |
| QSV38_RS02365 (QSV38_02365) | - | 462647..463330 (-) | 684 | WP_289649062.1 | AAA family ATPase | - |
| QSV38_RS02370 (QSV38_02370) | - | 463327..463629 (-) | 303 | WP_289649063.1 | hypothetical protein | - |
| QSV38_RS02375 (QSV38_02375) | - | 463626..463814 (-) | 189 | WP_289649064.1 | hypothetical protein | - |
| QSV38_RS02380 (QSV38_02380) | - | 463947..464096 (-) | 150 | WP_289649065.1 | hypothetical protein | - |
| QSV38_RS02385 (QSV38_02385) | - | 464086..464325 (-) | 240 | WP_289649066.1 | hypothetical protein | - |
| QSV38_RS02390 (QSV38_02390) | - | 464322..464597 (-) | 276 | WP_289649067.1 | DNA-binding protein | - |
| QSV38_RS02395 (QSV38_02395) | - | 464768..464911 (+) | 144 | WP_289649068.1 | hypothetical protein | - |
| QSV38_RS02400 (QSV38_02400) | - | 465072..465815 (-) | 744 | WP_289649069.1 | BRO family protein | - |
| QSV38_RS02405 (QSV38_02405) | - | 465869..466084 (+) | 216 | WP_289649070.1 | hypothetical protein | - |
| QSV38_RS02410 (QSV38_02410) | - | 466188..466355 (-) | 168 | WP_354318706.1 | hypothetical protein | - |
| QSV38_RS02415 (QSV38_02415) | - | 466364..466582 (-) | 219 | WP_289649071.1 | antA/AntB antirepressor family protein | - |
| QSV38_RS02420 (QSV38_02420) | - | 466636..466962 (+) | 327 | WP_289649072.1 | hypothetical protein | - |
| QSV38_RS02425 (QSV38_02425) | - | 466948..467082 (-) | 135 | WP_289649073.1 | hypothetical protein | - |
| QSV38_RS02430 (QSV38_02430) | - | 467116..467325 (-) | 210 | WP_289649074.1 | helix-turn-helix domain-containing protein | - |
| QSV38_RS02435 (QSV38_02435) | - | 467495..467836 (+) | 342 | WP_289649075.1 | helix-turn-helix transcriptional regulator | - |
| QSV38_RS02440 (QSV38_02440) | - | 467846..468196 (+) | 351 | WP_289649076.1 | ImmA/IrrE family metallo-endopeptidase | - |
| QSV38_RS02445 (QSV38_02445) | - | 468257..468871 (+) | 615 | WP_289649328.1 | CD20-like domain-containing protein | - |
| QSV38_RS02450 (QSV38_02450) | - | 469035..470093 (+) | 1059 | WP_289649077.1 | site-specific integrase | - |
| QSV38_RS02455 (QSV38_02455) | mnmE | 470152..471525 (+) | 1374 | WP_289649078.1 | tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE | - |
| QSV38_RS02460 (QSV38_02460) | - | 471842..472018 (+) | 177 | WP_289649079.1 | hypothetical protein | - |
| QSV38_RS02465 (QSV38_02465) | - | 472090..472671 (-) | 582 | WP_289649080.1 | LemA family protein | - |
| QSV38_RS02470 (QSV38_02470) | - | 472742..473524 (-) | 783 | WP_277843371.1 | TPM domain-containing protein | - |
| QSV38_RS02475 (QSV38_02475) | - | 473592..474173 (-) | 582 | WP_289649082.1 | uracil-DNA glycosylase family protein | - |
| QSV38_RS02480 (QSV38_02480) | - | 474700..474918 (-) | 219 | WP_277843367.1 | GntR family transcriptional regulator | - |
| QSV38_RS02485 (QSV38_02485) | - | 475328..476296 (-) | 969 | WP_171988588.1 | sugar phosphate isomerase/epimerase | - |
| QSV38_RS02490 (QSV38_02490) | - | 476366..477394 (-) | 1029 | WP_171988587.1 | Gfo/Idh/MocA family oxidoreductase | - |
| QSV38_RS02495 (QSV38_02495) | - | 477396..478079 (-) | 684 | WP_277836735.1 | sugar phosphate isomerase/epimerase | - |
| QSV38_RS02500 (QSV38_02500) | - | 478141..478860 (-) | 720 | WP_277843358.1 | ThuA domain-containing protein | - |
| QSV38_RS02505 (QSV38_02505) | - | 478914..479897 (-) | 984 | WP_289649083.1 | Gfo/Idh/MocA family oxidoreductase | - |
| QSV38_RS02510 (QSV38_02510) | - | 480099..480863 (+) | 765 | WP_289649084.1 | AraC family transcriptional regulator | - |
| QSV38_RS02515 (QSV38_02515) | - | 480933..481088 (-) | 156 | Protein_499 | carbohydrate ABC transporter permease | - |
| QSV38_RS02520 (QSV38_02520) | pepV | 481470..482870 (-) | 1401 | WP_217374906.1 | dipeptidase PepV | - |
| QSV38_RS02525 (QSV38_02525) | fetB | 482968..483732 (-) | 765 | WP_024396290.1 | iron export ABC transporter permease subunit FetB | - |
| QSV38_RS02530 (QSV38_02530) | - | 483729..484379 (-) | 651 | WP_277843353.1 | ATP-binding cassette domain-containing protein | - |
| QSV38_RS02535 (QSV38_02535) | - | 484369..484797 (-) | 429 | WP_172007025.1 | cupin domain-containing protein | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 7054.11 Da Isoelectric Point: 4.5843
>NTDB_id=847295 QSV38_RS02125 WP_289649012.1 428081..428260(-) (prx) [Streptococcus parasuis strain 7500]
MLEYEELKQAVNNGYIIGSKVNIVRRDGKIFDYILPREEVRPWEVVSEEKLDDVMRELK
MLEYEELKQAVNNGYIIGSKVNIVRRDGKIFDYILPREEVRPWEVVSEEKLDDVMRELK
Nucleotide
Download Length: 180 bp
>NTDB_id=847295 QSV38_RS02125 WP_289649012.1 428081..428260(-) (prx) [Streptococcus parasuis strain 7500]
ATGTTAGAATACGAAGAATTAAAACAAGCAGTAAATAATGGATATATAATAGGAAGCAAAGTTAACATCGTTCGTCGTGA
CGGTAAGATATTTGACTATATATTACCTAGAGAAGAAGTCAGACCTTGGGAAGTGGTGAGCGAAGAGAAGTTGGATGATG
TGATGAGGGAGTTAAAATAA
ATGTTAGAATACGAAGAATTAAAACAAGCAGTAAATAATGGATATATAATAGGAAGCAAAGTTAACATCGTTCGTCGTGA
CGGTAAGATATTTGACTATATATTACCTAGAGAAGAAGTCAGACCTTGGGAAGTGGTGAGCGAAGAGAAGTTGGATGATG
TGATGAGGGAGTTAAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
58.621 |
98.305 |
0.576 |
| prx | Streptococcus pyogenes MGAS315 |
58.621 |
98.305 |
0.576 |
| prx | Streptococcus pyogenes MGAS315 |
56.897 |
98.305 |
0.559 |
| prx | Streptococcus pyogenes MGAS315 |
50 |
98.305 |
0.492 |
| prx | Streptococcus pyogenes MGAS315 |
64.286 |
71.186 |
0.458 |
| prx | Streptococcus pyogenes MGAS315 |
60.976 |
69.492 |
0.424 |
| prx | Streptococcus pyogenes MGAS315 |
58.537 |
69.492 |
0.407 |