Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | QQ988_RS10685 | Genome accession | NZ_CP127869 |
| Coordinates | 2225607..2226035 (-) | Length | 142 a.a. |
| NCBI ID | WP_101750502.1 | Uniprot ID | - |
| Organism | Staphylococcus epidermidis strain NG02 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2188336..2233075 | 2225607..2226035 | within | 0 |
Gene organization within MGE regions
Location: 2188336..2233075
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ988_RS10405 (QQ988_10405) | - | 2188336..2189739 (-) | 1404 | WP_286096811.1 | N-acetylmuramoyl-L-alanine amidase | - |
| QQ988_RS10410 (QQ988_10410) | - | 2189777..2190415 (-) | 639 | WP_286096812.1 | AP2 domain-containing protein | - |
| QQ988_RS10415 (QQ988_10415) | - | 2190462..2190725 (-) | 264 | WP_286096813.1 | phage holin | - |
| QQ988_RS10420 (QQ988_10420) | - | 2190781..2191308 (-) | 528 | WP_286096814.1 | hypothetical protein | - |
| QQ988_RS10425 (QQ988_10425) | - | 2191308..2191817 (-) | 510 | WP_002475504.1 | hypothetical protein | - |
| QQ988_RS10430 (QQ988_10430) | - | 2191870..2193663 (-) | 1794 | Protein_2025 | glucosaminidase domain-containing protein | - |
| QQ988_RS10435 (QQ988_10435) | - | 2194068..2194469 (-) | 402 | WP_237642725.1 | hypothetical protein | - |
| QQ988_RS10440 (QQ988_10440) | - | 2194453..2194827 (-) | 375 | WP_286097130.1 | hypothetical protein | - |
| QQ988_RS10445 (QQ988_10445) | - | 2194910..2195050 (-) | 141 | WP_001830255.1 | XkdX family protein | - |
| QQ988_RS10450 (QQ988_10450) | - | 2195052..2195390 (-) | 339 | WP_002486362.1 | hypothetical protein | - |
| QQ988_RS10455 (QQ988_10455) | - | 2195395..2196927 (-) | 1533 | WP_286096815.1 | BppU family phage baseplate upper protein | - |
| QQ988_RS10460 (QQ988_10460) | - | 2196927..2199593 (-) | 2667 | WP_286096816.1 | peptidase G2 autoproteolytic cleavage domain-containing protein | - |
| QQ988_RS10465 (QQ988_10465) | - | 2199608..2201464 (-) | 1857 | WP_286096817.1 | SGNH/GDSL hydrolase family protein | - |
| QQ988_RS10470 (QQ988_10470) | - | 2201478..2202416 (-) | 939 | WP_286096818.1 | phage tail domain-containing protein | - |
| QQ988_RS10475 (QQ988_10475) | - | 2202432..2205536 (-) | 3105 | WP_286096819.1 | terminase | - |
| QQ988_RS10480 (QQ988_10480) | - | 2205539..2205841 (-) | 303 | WP_047499986.1 | hypothetical protein | - |
| QQ988_RS10485 (QQ988_10485) | - | 2205904..2206398 (-) | 495 | WP_002439227.1 | tail assembly chaperone | - |
| QQ988_RS10490 (QQ988_10490) | - | 2206457..2206996 (-) | 540 | WP_002470852.1 | tail protein | - |
| QQ988_RS10495 (QQ988_10495) | - | 2206983..2207420 (-) | 438 | WP_015984394.1 | DUF3168 domain-containing protein | - |
| QQ988_RS10500 (QQ988_10500) | - | 2207433..2207846 (-) | 414 | WP_286096820.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| QQ988_RS10505 (QQ988_10505) | - | 2207839..2208168 (-) | 330 | WP_049387161.1 | phage head closure protein | - |
| QQ988_RS10510 (QQ988_10510) | - | 2208161..2208475 (-) | 315 | WP_002504349.1 | phage head-tail connector protein | - |
| QQ988_RS10515 (QQ988_10515) | - | 2208475..2208765 (-) | 291 | WP_145939776.1 | Rho termination factor N-terminal domain-containing protein | - |
| QQ988_RS10520 (QQ988_10520) | - | 2208782..2209591 (-) | 810 | WP_145939775.1 | N4-gp56 family major capsid protein | - |
| QQ988_RS10525 (QQ988_10525) | - | 2209605..2210204 (-) | 600 | WP_145939774.1 | phage scaffolding protein | - |
| QQ988_RS10530 (QQ988_10530) | - | 2210308..2211261 (-) | 954 | WP_286096821.1 | phage head morphogenesis protein | - |
| QQ988_RS10535 (QQ988_10535) | - | 2211218..2212654 (-) | 1437 | WP_286096822.1 | phage portal protein | - |
| QQ988_RS10540 (QQ988_10540) | - | 2212660..2212959 (-) | 300 | Protein_2047 | terminase large subunit | - |
| QQ988_RS10545 (QQ988_10545) | - | 2213102..2213689 (-) | 588 | WP_286096823.1 | HNH endonuclease signature motif containing protein | - |
| QQ988_RS10550 (QQ988_10550) | - | 2213853..2214818 (-) | 966 | Protein_2049 | PBSX family phage terminase large subunit | - |
| QQ988_RS10555 (QQ988_10555) | - | 2214802..2215236 (-) | 435 | WP_237615256.1 | terminase small subunit | - |
| QQ988_RS10560 (QQ988_10560) | - | 2215755..2216171 (-) | 417 | WP_002439197.1 | hypothetical protein | - |
| QQ988_RS10565 (QQ988_10565) | - | 2216189..2216350 (-) | 162 | WP_230372884.1 | hypothetical protein | - |
| QQ988_RS10570 (QQ988_10570) | - | 2216407..2216544 (-) | 138 | WP_237619501.1 | hypothetical protein | - |
| QQ988_RS10575 (QQ988_10575) | - | 2216751..2216921 (-) | 171 | WP_286097131.1 | transcriptional regulator | - |
| QQ988_RS10580 (QQ988_10580) | - | 2216943..2217065 (-) | 123 | Protein_2055 | DUF1381 domain-containing protein | - |
| QQ988_RS10585 (QQ988_10585) | - | 2217102..2217629 (-) | 528 | WP_286096824.1 | dUTP pyrophosphatase | - |
| QQ988_RS10590 (QQ988_10590) | - | 2217630..2217809 (-) | 180 | WP_162153391.1 | hypothetical protein | - |
| QQ988_RS10595 (QQ988_10595) | - | 2217810..2217986 (-) | 177 | WP_286096825.1 | hypothetical protein | - |
| QQ988_RS10600 (QQ988_10600) | - | 2217973..2218242 (-) | 270 | WP_286096826.1 | hypothetical protein | - |
| QQ988_RS10605 (QQ988_10605) | - | 2218243..2218551 (-) | 309 | WP_286096827.1 | hypothetical protein | - |
| QQ988_RS10610 (QQ988_10610) | - | 2218555..2218899 (-) | 345 | WP_195212704.1 | thermonuclease family protein | - |
| QQ988_RS10615 (QQ988_10615) | - | 2218900..2219277 (-) | 378 | WP_286096828.1 | YopX family protein | - |
| QQ988_RS10620 (QQ988_10620) | - | 2219274..2219459 (-) | 186 | WP_286096829.1 | hypothetical protein | - |
| QQ988_RS10625 (QQ988_10625) | - | 2219456..2220136 (-) | 681 | WP_286096830.1 | hypothetical protein | - |
| QQ988_RS10630 (QQ988_10630) | - | 2220139..2220750 (-) | 612 | WP_256099439.1 | NUMOD4 domain-containing protein | - |
| QQ988_RS10635 (QQ988_10635) | - | 2220716..2221165 (-) | 450 | WP_286096831.1 | DUF3310 domain-containing protein | - |
| QQ988_RS10640 (QQ988_10640) | - | 2221162..2221575 (-) | 414 | WP_286096832.1 | SA1788 family PVL leukocidin-associated protein | - |
| QQ988_RS10645 (QQ988_10645) | - | 2221576..2221767 (-) | 192 | WP_070653566.1 | hypothetical protein | - |
| QQ988_RS10650 (QQ988_10650) | - | 2221768..2222175 (-) | 408 | WP_070858014.1 | RusA family crossover junction endodeoxyribonuclease | - |
| QQ988_RS10655 (QQ988_10655) | - | 2222184..2222429 (-) | 246 | WP_286096833.1 | hypothetical protein | - |
| QQ988_RS10660 (QQ988_10660) | - | 2222407..2222628 (-) | 222 | WP_070858718.1 | hypothetical protein | - |
| QQ988_RS10665 (QQ988_10665) | - | 2222625..2223872 (-) | 1248 | WP_286096834.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| QQ988_RS10670 (QQ988_10670) | - | 2223862..2224215 (-) | 354 | WP_286096835.1 | hypothetical protein | - |
| QQ988_RS10675 (QQ988_10675) | - | 2224221..2224922 (-) | 702 | WP_286096836.1 | helix-turn-helix domain-containing protein | - |
| QQ988_RS10680 (QQ988_10680) | - | 2224919..2225593 (-) | 675 | WP_286096837.1 | putative HNHc nuclease | - |
| QQ988_RS10685 (QQ988_10685) | ssbA | 2225607..2226035 (-) | 429 | WP_101750502.1 | single-stranded DNA-binding protein | Machinery gene |
| QQ988_RS10690 (QQ988_10690) | - | 2226025..2226654 (-) | 630 | WP_286096838.1 | DUF1071 domain-containing protein | - |
| QQ988_RS10695 (QQ988_10695) | - | 2226647..2226871 (-) | 225 | WP_286096839.1 | DUF2483 family protein | - |
| QQ988_RS10700 (QQ988_10700) | - | 2226843..2227118 (-) | 276 | WP_286096840.1 | chordopoxvirus fusion protein | - |
| QQ988_RS10705 (QQ988_10705) | - | 2227173..2227349 (-) | 177 | WP_286096841.1 | hypothetical protein | - |
| QQ988_RS10710 (QQ988_10710) | - | 2227362..2227601 (-) | 240 | WP_286096842.1 | hypothetical protein | - |
| QQ988_RS10715 (QQ988_10715) | - | 2227705..2227866 (-) | 162 | WP_002504371.1 | hypothetical protein | - |
| QQ988_RS10720 (QQ988_10720) | - | 2227948..2228790 (-) | 843 | WP_237615771.1 | ParB N-terminal domain-containing protein | - |
| QQ988_RS10725 (QQ988_10725) | - | 2228794..2229594 (-) | 801 | WP_237647672.1 | DUF3102 domain-containing protein | - |
| QQ988_RS10730 (QQ988_10730) | - | 2229641..2229847 (+) | 207 | WP_203085078.1 | hypothetical protein | - |
| QQ988_RS10735 (QQ988_10735) | - | 2229836..2230000 (-) | 165 | WP_203085077.1 | hypothetical protein | - |
| QQ988_RS10740 (QQ988_10740) | - | 2230018..2230278 (-) | 261 | WP_203085076.1 | helix-turn-helix transcriptional regulator | - |
| QQ988_RS10745 (QQ988_10745) | - | 2230473..2231111 (+) | 639 | WP_286096843.1 | XRE family transcriptional regulator | - |
| QQ988_RS10750 (QQ988_10750) | - | 2231165..2231647 (+) | 483 | WP_286096844.1 | hypothetical protein | - |
| QQ988_RS10755 (QQ988_10755) | - | 2231699..2233075 (+) | 1377 | WP_286096845.1 | recombinase family protein | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 15889.63 Da Isoelectric Point: 9.6205
>NTDB_id=844923 QQ988_RS10685 WP_101750502.1 2225607..2226035(-) (ssbA) [Staphylococcus epidermidis strain NG02]
MLNRVVLVGRLTKDPEFRTTPSGVEVATFTLAVNRTFTNAQGEREADFINVVVFRKQAKNVNDYLSKGSLAGVDGRVQSR
SYENQEGRRVFVTEVVADSVQFLDTKGNNQQNNQPQKQQKQTTTKNNPFANGTDMDSSELPF
MLNRVVLVGRLTKDPEFRTTPSGVEVATFTLAVNRTFTNAQGEREADFINVVVFRKQAKNVNDYLSKGSLAGVDGRVQSR
SYENQEGRRVFVTEVVADSVQFLDTKGNNQQNNQPQKQQKQTTTKNNPFANGTDMDSSELPF
Nucleotide
Download Length: 429 bp
>NTDB_id=844923 QQ988_RS10685 WP_101750502.1 2225607..2226035(-) (ssbA) [Staphylococcus epidermidis strain NG02]
ATGTTAAATAGAGTTGTATTAGTAGGAAGATTAACGAAAGATCCAGAGTTTAGAACTACGCCGAGTGGAGTTGAAGTAGC
AACATTCACATTAGCAGTAAACAGAACATTTACTAACGCACAAGGTGAACGAGAAGCAGATTTCATCAATGTAGTTGTAT
TCAGAAAACAAGCGAAGAATGTAAACGATTATCTTTCAAAAGGCTCACTAGCAGGTGTAGATGGACGTGTTCAATCACGC
AGCTATGAAAATCAAGAAGGTCGTCGAGTATTTGTAACAGAAGTTGTGGCCGATAGCGTTCAGTTCTTAGATACCAAAGG
CAACAACCAACAAAACAACCAACCTCAAAAGCAACAAAAACAAACCACAACTAAAAATAATCCTTTTGCTAACGGTACAG
ACATGGATAGTTCAGAATTGCCGTTCTGA
ATGTTAAATAGAGTTGTATTAGTAGGAAGATTAACGAAAGATCCAGAGTTTAGAACTACGCCGAGTGGAGTTGAAGTAGC
AACATTCACATTAGCAGTAAACAGAACATTTACTAACGCACAAGGTGAACGAGAAGCAGATTTCATCAATGTAGTTGTAT
TCAGAAAACAAGCGAAGAATGTAAACGATTATCTTTCAAAAGGCTCACTAGCAGGTGTAGATGGACGTGTTCAATCACGC
AGCTATGAAAATCAAGAAGGTCGTCGAGTATTTGTAACAGAAGTTGTGGCCGATAGCGTTCAGTTCTTAGATACCAAAGG
CAACAACCAACAAAACAACCAACCTCAAAAGCAACAAAAACAAACCACAACTAAAAATAATCCTTTTGCTAACGGTACAG
ACATGGATAGTTCAGAATTGCCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
53.714 |
100 |
0.662 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
46.471 |
100 |
0.556 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
60.377 |
74.648 |
0.451 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
40.278 |
100 |
0.408 |
| ssbA | Streptococcus mutans UA159 |
38.732 |
100 |
0.387 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
36.111 |
100 |
0.366 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
36.111 |
100 |
0.366 |