Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | H7675_RS03810 | Genome accession | NZ_AP023389 |
| Coordinates | 721831..722013 (+) | Length | 60 a.a. |
| NCBI ID | WP_011184726.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain KUN-0012590 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 681819..722013 | 721831..722013 | within | 0 |
Gene organization within MGE regions
Location: 681819..722013
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7675_RS03520 (KUN2590_06330) | recN | 681819..683480 (+) | 1662 | WP_031488539.1 | DNA repair protein RecN | - |
| H7675_RS03525 (KUN2590_06340) | - | 683688..684644 (+) | 957 | WP_023079365.1 | LPXTG cell wall anchor domain-containing protein | - |
| H7675_RS03530 (KUN2590_06350) | - | 684872..685711 (+) | 840 | WP_002989125.1 | DegV family protein | - |
| H7675_RS03535 (KUN2590_06360) | - | 685704..686546 (+) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
| H7675_RS03540 (KUN2590_06370) | - | 686524..687111 (+) | 588 | WP_002989129.1 | YpmS family protein | - |
| H7675_RS03545 (KUN2590_06380) | - | 687210..687485 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| H7675_RS03550 (KUN2590_06390) | - | 687574..688716 (-) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| H7675_RS03555 (KUN2590_06400) | - | 688840..689358 (-) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| H7675_RS03560 (KUN2590_06410) | - | 689370..690125 (-) | 756 | WP_010922480.1 | helix-turn-helix domain-containing protein | - |
| H7675_RS03565 (KUN2590_06420) | - | 690327..690539 (+) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| H7675_RS03570 (KUN2590_06430) | - | 690809..691120 (+) | 312 | WP_010922478.1 | excisionase | - |
| H7675_RS03575 (KUN2590_06440) | - | 691122..691307 (+) | 186 | WP_010922477.1 | hypothetical protein | - |
| H7675_RS09290 (KUN2590_06450) | - | 691401..691670 (+) | 270 | WP_011106700.1 | replication protein | - |
| H7675_RS03580 (KUN2590_06460) | - | 691811..692197 (+) | 387 | WP_002990076.1 | DnaD domain-containing protein | - |
| H7675_RS03585 (KUN2590_06470) | - | 692178..692411 (+) | 234 | WP_002988350.1 | hypothetical protein | - |
| H7675_RS03590 (KUN2590_06480) | - | 692408..692548 (+) | 141 | WP_002988354.1 | hypothetical protein | - |
| H7675_RS03595 (KUN2590_06490) | - | 692557..692763 (+) | 207 | WP_002990074.1 | hypothetical protein | - |
| H7675_RS03600 (KUN2590_06500) | - | 692819..693148 (+) | 330 | WP_010922207.1 | hypothetical protein | - |
| H7675_RS03605 (KUN2590_06510) | - | 693151..694077 (+) | 927 | WP_011054700.1 | recombinase RecT | - |
| H7675_RS03610 (KUN2590_06520) | - | 694074..694274 (+) | 201 | WP_000594115.1 | hypothetical protein | - |
| H7675_RS03615 (KUN2590_06530) | - | 694267..695064 (+) | 798 | WP_011054699.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| H7675_RS03620 (KUN2590_06540) | - | 695429..695824 (+) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| H7675_RS03625 (KUN2590_06550) | - | 695821..697167 (+) | 1347 | WP_011054697.1 | PcfJ domain-containing protein | - |
| H7675_RS03630 (KUN2590_06560) | - | 697178..697510 (+) | 333 | WP_011184741.1 | hypothetical protein | - |
| H7675_RS03635 (KUN2590_06570) | - | 697507..698019 (+) | 513 | WP_011054695.1 | hypothetical protein | - |
| H7675_RS03640 (KUN2590_06580) | - | 698055..698372 (+) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| H7675_RS03645 (KUN2590_06590) | - | 698369..698524 (+) | 156 | WP_011054693.1 | hypothetical protein | - |
| H7675_RS03650 (KUN2590_06600) | - | 698521..698772 (+) | 252 | WP_011054692.1 | hypothetical protein | - |
| H7675_RS03655 (KUN2590_06610) | - | 698848..699267 (+) | 420 | WP_011054691.1 | DUF1492 domain-containing protein | - |
| H7675_RS03660 (KUN2590_06620) | - | 699375..699719 (+) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| H7675_RS03665 (KUN2590_06630) | - | 699867..700223 (+) | 357 | WP_002994106.1 | hypothetical protein | - |
| H7675_RS03670 (KUN2590_06640) | - | 700220..701488 (+) | 1269 | WP_010922468.1 | phage portal protein | - |
| H7675_RS03675 (KUN2590_06650) | - | 701481..702974 (+) | 1494 | WP_010922467.1 | hypothetical protein | - |
| H7675_RS03680 (KUN2590_06660) | - | 702980..703204 (+) | 225 | WP_002994100.1 | hypothetical protein | - |
| H7675_RS03685 (KUN2590_06670) | - | 703281..703433 (+) | 153 | WP_011054687.1 | hypothetical protein | - |
| H7675_RS03690 (KUN2590_06680) | - | 703426..703692 (+) | 267 | WP_002986828.1 | hypothetical protein | - |
| H7675_RS03695 (KUN2590_06690) | - | 703694..703909 (+) | 216 | WP_011106704.1 | hypothetical protein | - |
| H7675_RS03700 (KUN2590_06700) | - | 703991..705406 (+) | 1416 | WP_011054685.1 | terminase | - |
| H7675_RS03705 (KUN2590_06710) | - | 705487..705948 (+) | 462 | WP_010922462.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| H7675_RS03710 (KUN2590_06720) | - | 705973..706884 (+) | 912 | WP_011054683.1 | phage major capsid protein | - |
| H7675_RS03715 (KUN2590_06730) | - | 706884..707084 (+) | 201 | WP_010922460.1 | hypothetical protein | - |
| H7675_RS03720 (KUN2590_06740) | - | 707094..707516 (+) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| H7675_RS03725 (KUN2590_06750) | - | 707476..707814 (+) | 339 | WP_011054681.1 | hypothetical protein | - |
| H7675_RS03730 (KUN2590_06760) | - | 707807..708043 (+) | 237 | WP_000032787.1 | hypothetical protein | - |
| H7675_RS03735 (KUN2590_06770) | - | 708044..708379 (+) | 336 | WP_000573598.1 | hypothetical protein | - |
| H7675_RS03740 (KUN2590_06780) | - | 708395..708985 (+) | 591 | WP_011054679.1 | hypothetical protein | - |
| H7675_RS03745 (KUN2590_06790) | - | 708996..709259 (+) | 264 | WP_010922455.1 | hypothetical protein | - |
| H7675_RS03750 (KUN2590_06800) | - | 709274..709645 (+) | 372 | WP_011054678.1 | DUF5361 domain-containing protein | - |
| H7675_RS03755 (KUN2590_06810) | - | 709645..712008 (+) | 2364 | WP_184004923.1 | hypothetical protein | - |
| H7675_RS03760 (KUN2590_06820) | - | 712005..712700 (+) | 696 | WP_002992579.1 | hypothetical protein | - |
| H7675_RS03765 (KUN2590_06830) | - | 712682..714655 (+) | 1974 | WP_011054676.1 | phage tail spike protein | - |
| H7675_RS03770 (KUN2590_06840) | - | 714655..715764 (+) | 1110 | WP_011184734.1 | hyaluronoglucosaminidase | - |
| H7675_RS03775 (KUN2590_06850) | - | 715779..717560 (+) | 1782 | WP_011184733.1 | gp58-like family protein | - |
| H7675_RS03780 (KUN2590_06860) | - | 717569..717997 (+) | 429 | WP_011184732.1 | DUF1617 family protein | - |
| H7675_RS03785 (KUN2590_06870) | - | 718000..718611 (+) | 612 | WP_011184731.1 | DUF1366 domain-containing protein | - |
| H7675_RS03790 (KUN2590_06880) | - | 718621..719076 (+) | 456 | WP_011184730.1 | phage holin family protein | - |
| H7675_RS03795 (KUN2590_06890) | - | 719194..719946 (+) | 753 | WP_030126404.1 | CHAP domain-containing protein | - |
| H7675_RS03800 (KUN2590_06900) | speC | 720015..720722 (-) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| H7675_RS03805 (KUN2590_06910) | mf2 | 720833..721591 (-) | 759 | WP_011184727.1 | DNase Mf2 | - |
| H7675_RS03810 (KUN2590_06920) | prx | 721831..722013 (+) | 183 | WP_011184726.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6936.91 Da Isoelectric Point: 4.1954
>NTDB_id=82788 H7675_RS03810 WP_011184726.1 721831..722013(+) (prx) [Streptococcus pyogenes strain KUN-0012590]
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=82788 H7675_RS03810 WP_011184726.1 721831..722013(+) (prx) [Streptococcus pyogenes strain KUN-0012590]
ATGCTAACATACGACGAATTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS8232 |
86.667 |
100 |
0.867 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
68.333 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
70 |
0.5 |