Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | H7674_RS04280 | Genome accession | NZ_AP023388 |
| Coordinates | 847995..848183 (+) | Length | 62 a.a. |
| NCBI ID | WP_002993136.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NIH35 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 801241..850300 | 847995..848183 | within | 0 |
Gene organization within MGE regions
Location: 801241..850300
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7674_RS03940 (SPNIH35_07230) | - | 801241..801861 (-) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
| H7674_RS03945 (SPNIH35_07240) | - | 802224..803312 (-) | 1089 | WP_023079773.1 | site-specific integrase | - |
| H7674_RS03950 (SPNIH35_07250) | - | 803562..804371 (-) | 810 | WP_002984270.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| H7674_RS03955 (SPNIH35_07260) | - | 804384..805127 (-) | 744 | WP_011284884.1 | XRE family transcriptional regulator | - |
| H7674_RS03960 (SPNIH35_07270) | - | 805485..805634 (+) | 150 | WP_021340643.1 | hypothetical protein | - |
| H7674_RS03965 (SPNIH35_07280) | - | 805620..805835 (-) | 216 | WP_021341080.1 | hypothetical protein | - |
| H7674_RS03970 (SPNIH35_07290) | - | 805894..806052 (+) | 159 | WP_011284883.1 | hypothetical protein | - |
| H7674_RS03975 (SPNIH35_07300) | - | 806082..806681 (-) | 600 | WP_011284882.1 | hypothetical protein | - |
| H7674_RS03980 (SPNIH35_07310) | - | 806735..806944 (+) | 210 | WP_011284881.1 | hypothetical protein | - |
| H7674_RS03985 (SPNIH35_07320) | - | 806933..807319 (-) | 387 | WP_011054589.1 | hypothetical protein | - |
| H7674_RS03990 (SPNIH35_07330) | - | 807393..807620 (+) | 228 | WP_002984281.1 | hypothetical protein | - |
| H7674_RS03995 (SPNIH35_07340) | - | 807728..808237 (-) | 510 | WP_011017884.1 | hypothetical protein | - |
| H7674_RS04000 (SPNIH35_07360) | - | 808496..808705 (-) | 210 | WP_002984292.1 | hypothetical protein | - |
| H7674_RS04005 (SPNIH35_07370) | - | 808855..809094 (-) | 240 | WP_011284879.1 | hypothetical protein | - |
| H7674_RS04010 (SPNIH35_07380) | - | 809261..809446 (+) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| H7674_RS04015 (SPNIH35_07390) | - | 809525..809821 (+) | 297 | WP_011017882.1 | MerR family transcriptional regulator | - |
| H7674_RS04020 (SPNIH35_07400) | - | 809818..809955 (+) | 138 | WP_011017881.1 | hypothetical protein | - |
| H7674_RS04025 (SPNIH35_07410) | - | 810036..810365 (+) | 330 | WP_011284878.1 | hypothetical protein | - |
| H7674_RS04030 (SPNIH35_07420) | - | 810365..810559 (+) | 195 | WP_002984315.1 | hypothetical protein | - |
| H7674_RS04035 (SPNIH35_07430) | - | 810556..810840 (+) | 285 | WP_011284877.1 | hypothetical protein | - |
| H7674_RS04040 (SPNIH35_07440) | - | 810837..811520 (+) | 684 | WP_002984321.1 | AAA family ATPase | - |
| H7674_RS04045 (SPNIH35_07450) | - | 811526..812959 (+) | 1434 | Protein_747 | DEAD/DEAH box helicase | - |
| H7674_RS04050 (SPNIH35_07460) | - | 812964..813446 (+) | 483 | WP_002984328.1 | DUF669 domain-containing protein | - |
| H7674_RS04055 (SPNIH35_07470) | - | 813464..815017 (+) | 1554 | WP_011284875.1 | hypothetical protein | - |
| H7674_RS04060 (SPNIH35_07480) | - | 815286..816155 (+) | 870 | WP_014635521.1 | bifunctional DNA primase/polymerase | - |
| H7674_RS04065 (SPNIH35_07490) | - | 816175..816459 (+) | 285 | WP_011284874.1 | VRR-NUC domain-containing protein | - |
| H7674_RS04070 (SPNIH35_07500) | - | 816443..816799 (+) | 357 | WP_011284873.1 | hypothetical protein | - |
| H7674_RS09280 (SPNIH35_07510) | - | 816796..817041 (+) | 246 | WP_011284872.1 | hypothetical protein | - |
| H7674_RS04075 (SPNIH35_07520) | - | 817041..817277 (+) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| H7674_RS04080 (SPNIH35_07530) | - | 817274..817444 (+) | 171 | WP_002995952.1 | hypothetical protein | - |
| H7674_RS04085 (SPNIH35_07540) | - | 817441..817725 (+) | 285 | WP_011284869.1 | hypothetical protein | - |
| H7674_RS04090 (SPNIH35_07550) | - | 817727..818359 (+) | 633 | WP_011888685.1 | N-6 DNA methylase | - |
| H7674_RS04095 (SPNIH35_07560) | - | 818364..818843 (+) | 480 | WP_011888686.1 | DUF1642 domain-containing protein | - |
| H7674_RS04100 (SPNIH35_07580) | - | 819292..819726 (+) | 435 | WP_011284866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| H7674_RS04105 (SPNIH35_07590) | - | 820304..821218 (+) | 915 | WP_011284864.1 | hypothetical protein | - |
| H7674_RS04110 (SPNIH35_07600) | - | 821308..821541 (-) | 234 | WP_002995461.1 | hypothetical protein | - |
| H7674_RS04115 (SPNIH35_07610) | - | 821836..822213 (-) | 378 | WP_002987543.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| H7674_RS04120 (SPNIH35_07620) | - | 822265..822450 (-) | 186 | WP_001132273.1 | type II toxin-antitoxin system HicA family toxin | - |
| H7674_RS04125 (SPNIH35_07630) | - | 822549..822980 (+) | 432 | WP_023079766.1 | terminase small subunit | - |
| H7674_RS04130 (SPNIH35_07640) | - | 822958..824265 (+) | 1308 | WP_020833530.1 | PBSX family phage terminase large subunit | - |
| H7674_RS04135 (SPNIH35_07650) | - | 824277..825779 (+) | 1503 | WP_002984369.1 | phage portal protein | - |
| H7674_RS04140 (SPNIH35_07660) | - | 825760..827322 (+) | 1563 | WP_011284860.1 | phage head morphogenesis protein | - |
| H7674_RS04145 (SPNIH35_07670) | - | 827326..827511 (+) | 186 | WP_002988389.1 | hypothetical protein | - |
| H7674_RS04150 (SPNIH35_07680) | - | 827581..827895 (+) | 315 | WP_011284859.1 | hypothetical protein | - |
| H7674_RS04155 (SPNIH35_07690) | - | 827898..828164 (+) | 267 | WP_011284858.1 | hypothetical protein | - |
| H7674_RS04160 (SPNIH35_07700) | - | 828308..828841 (+) | 534 | WP_023079765.1 | DUF4355 domain-containing protein | - |
| H7674_RS04165 (SPNIH35_07710) | - | 828851..829231 (+) | 381 | WP_011284856.1 | head decoration protein | - |
| H7674_RS04170 (SPNIH35_07720) | - | 829234..830316 (+) | 1083 | WP_011284855.1 | major capsid protein | - |
| H7674_RS04175 (SPNIH35_07730) | - | 830326..830568 (+) | 243 | WP_011284854.1 | HeH/LEM domain-containing protein | - |
| H7674_RS04180 (SPNIH35_07740) | - | 830582..830935 (+) | 354 | WP_002984392.1 | phage head-tail connector protein | - |
| H7674_RS04185 (SPNIH35_07750) | - | 830932..831240 (+) | 309 | WP_011284852.1 | hypothetical protein | - |
| H7674_RS04190 (SPNIH35_07760) | - | 831221..831586 (+) | 366 | WP_030126607.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| H7674_RS04195 (SPNIH35_07770) | - | 831583..831972 (+) | 390 | WP_011284850.1 | hypothetical protein | - |
| H7674_RS04200 (SPNIH35_07780) | - | 832027..832650 (+) | 624 | WP_030126608.1 | phage major tail protein, TP901-1 family | - |
| H7674_RS04205 (SPNIH35_07790) | - | 832704..833057 (+) | 354 | WP_002990023.1 | tail assembly chaperone | - |
| H7674_RS04210 (SPNIH35_07800) | - | 833132..833428 (+) | 297 | WP_021340179.1 | hypothetical protein | - |
| H7674_RS04215 (SPNIH35_07810) | - | 833443..837078 (+) | 3636 | WP_011284846.1 | tape measure protein | - |
| H7674_RS04220 (SPNIH35_07820) | - | 837110..837889 (+) | 780 | WP_011284845.1 | distal tail protein Dit | - |
| H7674_RS04225 (SPNIH35_07830) | - | 837886..839940 (+) | 2055 | WP_011284844.1 | phage tail spike protein | - |
| H7674_RS04230 (SPNIH35_07840) | - | 839937..841151 (+) | 1215 | WP_011284843.1 | hypothetical protein | - |
| H7674_RS04235 (SPNIH35_07850) | - | 841153..841467 (+) | 315 | WP_021340983.1 | hypothetical protein | - |
| H7674_RS04240 (SPNIH35_07860) | - | 841478..843373 (+) | 1896 | WP_184000945.1 | gp58-like family protein | - |
| H7674_RS04245 (SPNIH35_07870) | - | 843387..843548 (+) | 162 | WP_002988795.1 | hypothetical protein | - |
| H7674_RS04250 (SPNIH35_07880) | - | 843551..844168 (+) | 618 | WP_011284840.1 | hypothetical protein | - |
| H7674_RS04255 (SPNIH35_07890) | - | 844179..844475 (+) | 297 | WP_002990012.1 | hypothetical protein | - |
| H7674_RS04260 (SPNIH35_07900) | - | 844472..844657 (+) | 186 | WP_011284839.1 | holin | - |
| H7674_RS04265 (SPNIH35_07910) | - | 844769..846103 (+) | 1335 | WP_011284838.1 | GH25 family lysozyme | - |
| H7674_RS04270 (SPNIH35_07920) | speC | 846179..846886 (-) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| H7674_RS04275 (SPNIH35_07930) | mf2 | 846997..847755 (-) | 759 | WP_011184727.1 | DNase Mf2 | - |
| H7674_RS04280 (SPNIH35_07940) | prx | 847995..848183 (+) | 189 | WP_002993136.1 | hypothetical protein | Regulator |
| H7674_RS04290 (SPNIH35_07950) | - | 848774..849388 (+) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| H7674_RS04295 (SPNIH35_07960) | - | 849515..850300 (-) | 786 | WP_002984433.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7239.28 Da Isoelectric Point: 3.9944
>NTDB_id=82737 H7674_RS04280 WP_002993136.1 847995..848183(+) (prx) [Streptococcus pyogenes strain NIH35]
MLTYDEFKQAIDNGYITGDTVIIVRKNGQIFDYVLPGEKVRPWEVVTEEVVEEVMVELDYIK
MLTYDEFKQAIDNGYITGDTVIIVRKNGQIFDYVLPGEKVRPWEVVTEEVVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=82737 H7674_RS04280 WP_002993136.1 847995..848183(+) (prx) [Streptococcus pyogenes strain NIH35]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTAATAATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGTGAGAAAGTCAGACCATGGGAGGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTAATAATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGTGAGAAAGTCAGACCATGGGAGGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
85.484 |
100 |
0.855 |
| prx | Streptococcus pyogenes MGAS8232 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
81.356 |
95.161 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
81.356 |
95.161 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
79.31 |
93.548 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
95.238 |
67.742 |
0.645 |
| prx | Streptococcus pyogenes MGAS315 |
80.488 |
66.129 |
0.532 |