Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | KUN2590_RS05910 | Genome accession | NZ_AP023387 |
| Coordinates | 1113985..1114173 (-) | Length | 62 a.a. |
| NCBI ID | WP_011054546.1 | Uniprot ID | A0A5S4TJS4 |
| Organism | Streptococcus pyogenes strain NIH34 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1106397..1153572 | 1113985..1114173 | within | 0 |
Gene organization within MGE regions
Location: 1106397..1153572
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KUN2590_RS05875 (SPNIH34_11220) | pfkA | 1106397..1107410 (-) | 1014 | WP_011054544.1 | 6-phosphofructokinase | - |
| KUN2590_RS05880 (SPNIH34_11230) | - | 1107490..1110600 (-) | 3111 | WP_011054545.1 | DNA polymerase III subunit alpha | - |
| KUN2590_RS05885 (SPNIH34_11240) | - | 1110785..1111156 (+) | 372 | WP_002989617.1 | GntR family transcriptional regulator | - |
| KUN2590_RS05890 (SPNIH34_11250) | - | 1111156..1111854 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| KUN2590_RS05895 (SPNIH34_11260) | - | 1111864..1112649 (+) | 786 | WP_002984433.1 | hypothetical protein | - |
| KUN2590_RS05900 (SPNIH34_11270) | - | 1112780..1113394 (-) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| KUN2590_RS05910 (SPNIH34_11280) | prx | 1113985..1114173 (-) | 189 | WP_011054546.1 | hypothetical protein | Regulator |
| KUN2590_RS05915 (SPNIH34_11290) | entC3 | 1114286..1115068 (-) | 783 | WP_002988472.1 | enterotoxin type C3 EntC3 | - |
| KUN2590_RS05920 (SPNIH34_11300) | - | 1115281..1116405 (-) | 1125 | WP_011054547.1 | Fic family protein | - |
| KUN2590_RS05925 (SPNIH34_11310) | - | 1116543..1117751 (-) | 1209 | WP_011054548.1 | glucosaminidase domain-containing protein | - |
| KUN2590_RS05930 (SPNIH34_11320) | - | 1117867..1118094 (-) | 228 | WP_011054444.1 | phage holin | - |
| KUN2590_RS05935 (SPNIH34_11330) | - | 1118091..1118363 (-) | 273 | WP_011017397.1 | hypothetical protein | - |
| KUN2590_RS05940 (SPNIH34_11340) | - | 1118375..1119007 (-) | 633 | WP_011054443.1 | hypothetical protein | - |
| KUN2590_RS05945 (SPNIH34_11350) | - | 1119010..1119438 (-) | 429 | WP_002988448.1 | DUF1617 family protein | - |
| KUN2590_RS05950 (SPNIH34_11360) | - | 1119450..1121354 (-) | 1905 | WP_011054442.1 | gp58-like family protein | - |
| KUN2590_RS05955 (SPNIH34_11370) | - | 1121364..1122371 (-) | 1008 | WP_011054441.1 | hyaluronoglucosaminidase | - |
| KUN2590_RS05960 (SPNIH34_11380) | - | 1122368..1124419 (-) | 2052 | WP_041174278.1 | phage tail spike protein | - |
| KUN2590_RS05965 (SPNIH34_11390) | - | 1124416..1125186 (-) | 771 | WP_011017392.1 | distal tail protein Dit | - |
| KUN2590_RS05970 (SPNIH34_11400) | - | 1125199..1129299 (-) | 4101 | WP_011054439.1 | phage tail tape measure protein | - |
| KUN2590_RS05975 (SPNIH34_11410) | gpG | 1129525..1129827 (-) | 303 | WP_011017390.1 | phage tail assembly chaperone G | - |
| KUN2590_RS05980 (SPNIH34_11420) | - | 1129920..1130504 (-) | 585 | WP_011017389.1 | major tail protein | - |
| KUN2590_RS05985 (SPNIH34_11430) | - | 1130516..1130896 (-) | 381 | WP_011017388.1 | hypothetical protein | - |
| KUN2590_RS05990 (SPNIH34_11440) | - | 1130889..1131287 (-) | 399 | WP_011017387.1 | HK97 gp10 family phage protein | - |
| KUN2590_RS05995 (SPNIH34_11450) | - | 1131289..1131651 (-) | 363 | WP_011017386.1 | hypothetical protein | - |
| KUN2590_RS06000 (SPNIH34_11460) | - | 1131644..1131952 (-) | 309 | WP_011054437.1 | hypothetical protein | - |
| KUN2590_RS06005 (SPNIH34_11470) | - | 1131952..1132125 (-) | 174 | WP_011017384.1 | hypothetical protein | - |
| KUN2590_RS06010 (SPNIH34_11480) | - | 1132139..1133272 (-) | 1134 | WP_011017383.1 | phage major capsid protein | - |
| KUN2590_RS06015 (SPNIH34_11490) | - | 1133289..1134095 (-) | 807 | WP_011017382.1 | head maturation protease, ClpP-related | - |
| KUN2590_RS06020 (SPNIH34_11500) | - | 1134076..1135263 (-) | 1188 | WP_011017381.1 | phage portal protein | - |
| KUN2590_RS06025 (SPNIH34_11510) | - | 1135416..1135628 (-) | 213 | WP_136260634.1 | hypothetical protein | - |
| KUN2590_RS06030 (SPNIH34_11520) | - | 1135631..1137361 (-) | 1731 | WP_011017380.1 | terminase large subunit domain-containing protein | - |
| KUN2590_RS06035 (SPNIH34_11530) | - | 1137374..1137691 (-) | 318 | WP_011017379.1 | P27 family phage terminase small subunit | - |
| KUN2590_RS06040 (SPNIH34_11540) | - | 1137832..1138137 (-) | 306 | WP_011017378.1 | HNH endonuclease | - |
| KUN2590_RS06045 (SPNIH34_11550) | - | 1138130..1138516 (-) | 387 | WP_011017377.1 | hypothetical protein | - |
| KUN2590_RS06050 (SPNIH34_11560) | - | 1138542..1138745 (-) | 204 | WP_011017376.1 | hypothetical protein | - |
| KUN2590_RS06055 (SPNIH34_11570) | - | 1138803..1139096 (-) | 294 | WP_011017375.1 | hypothetical protein | - |
| KUN2590_RS06060 (SPNIH34_11580) | - | 1139250..1139825 (-) | 576 | WP_011054435.1 | site-specific integrase | - |
| KUN2590_RS06065 (SPNIH34_11590) | - | 1139985..1140386 (-) | 402 | WP_011017373.1 | hypothetical protein | - |
| KUN2590_RS06070 (SPNIH34_11600) | - | 1140401..1141228 (-) | 828 | WP_011054433.1 | prohibitin family protein | - |
| KUN2590_RS06075 (SPNIH34_11610) | - | 1141230..1141568 (-) | 339 | WP_011054432.1 | helix-turn-helix domain-containing protein | - |
| KUN2590_RS06080 (SPNIH34_11620) | - | 1141565..1141846 (-) | 282 | WP_011054431.1 | hypothetical protein | - |
| KUN2590_RS06085 (SPNIH34_11630) | - | 1141861..1142052 (-) | 192 | Protein_1157 | single-stranded DNA-binding protein | - |
| KUN2590_RS06090 (SPNIH34_11640) | - | 1142012..1142524 (-) | 513 | WP_011054429.1 | DUF1642 domain-containing protein | - |
| KUN2590_RS06095 (SPNIH34_11650) | - | 1142529..1143161 (-) | 633 | WP_011054428.1 | N-6 DNA methylase | - |
| KUN2590_RS06100 (SPNIH34_11660) | - | 1143163..1143447 (-) | 285 | WP_011054427.1 | hypothetical protein | - |
| KUN2590_RS06105 (SPNIH34_11670) | - | 1143444..1143878 (-) | 435 | WP_011054426.1 | YopX family protein | - |
| KUN2590_RS06110 (SPNIH34_11680) | - | 1143895..1144101 (-) | 207 | WP_011054425.1 | hypothetical protein | - |
| KUN2590_RS06115 (SPNIH34_11690) | - | 1144115..1144342 (-) | 228 | WP_011054424.1 | hypothetical protein | - |
| KUN2590_RS09755 (SPNIH34_11700) | - | 1144342..1145154 (-) | 813 | Protein_1164 | ATP-binding protein | - |
| KUN2590_RS06125 (SPNIH34_11710) | - | 1145154..1145915 (-) | 762 | WP_011054422.1 | conserved phage C-terminal domain-containing protein | - |
| KUN2590_RS06130 (SPNIH34_11720) | dnaB | 1145908..1147248 (-) | 1341 | WP_011017360.1 | replicative DNA helicase | - |
| KUN2590_RS06135 (SPNIH34_11730) | - | 1147235..1147423 (-) | 189 | WP_032461348.1 | hypothetical protein | - |
| KUN2590_RS06140 (SPNIH34_11740) | - | 1147544..1147735 (-) | 192 | WP_011017359.1 | hypothetical protein | - |
| KUN2590_RS06145 (SPNIH34_11750) | - | 1147828..1148085 (-) | 258 | WP_011054421.1 | hypothetical protein | - |
| KUN2590_RS06150 (SPNIH34_11760) | - | 1148159..1148878 (-) | 720 | WP_011017357.1 | ORF6C domain-containing protein | - |
| KUN2590_RS06155 (SPNIH34_11770) | - | 1148920..1149429 (+) | 510 | WP_011106801.1 | hypothetical protein | - |
| KUN2590_RS09880 | - | 1149549..1149683 (-) | 135 | WP_011017356.1 | hypothetical protein | - |
| KUN2590_RS06160 (SPNIH34_11780) | - | 1149757..1149969 (-) | 213 | WP_011054420.1 | helix-turn-helix domain-containing protein | - |
| KUN2590_RS06165 (SPNIH34_11790) | - | 1150004..1150279 (-) | 276 | WP_011017354.1 | hypothetical protein | - |
| KUN2590_RS06170 (SPNIH34_11800) | - | 1150568..1150918 (+) | 351 | WP_011017353.1 | helix-turn-helix domain-containing protein | - |
| KUN2590_RS06175 (SPNIH34_11810) | - | 1150922..1151314 (+) | 393 | WP_011017352.1 | ImmA/IrrE family metallo-endopeptidase | - |
| KUN2590_RS06180 (SPNIH34_11820) | - | 1151325..1152065 (+) | 741 | WP_011017351.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| KUN2590_RS06185 (SPNIH34_11830) | - | 1152376..1153572 (+) | 1197 | WP_011017350.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7226.17 Da Isoelectric Point: 3.9947
>NTDB_id=82686 KUN2590_RS05910 WP_011054546.1 1113985..1114173(-) (prx) [Streptococcus pyogenes strain NIH34]
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=82686 KUN2590_RS05910 WP_011054546.1 1113985..1114173(-) (prx) [Streptococcus pyogenes strain NIH34]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
95.161 |
0.806 |
| prx | Streptococcus pyogenes MGAS8232 |
84.483 |
93.548 |
0.79 |
| prx | Streptococcus pyogenes MGAS315 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
77.966 |
95.161 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
66.129 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |