Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | KUN2590_RS05000 | Genome accession | NZ_AP023387 |
| Coordinates | 925004..925186 (+) | Length | 60 a.a. |
| NCBI ID | WP_029714017.1 | Uniprot ID | A0A5S4TLJ0 |
| Organism | Streptococcus pyogenes strain NIH34 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 884431..924805 | 925004..925186 | flank | 199 |
Gene organization within MGE regions
Location: 884431..925186
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KUN2590_RS04715 (SPNIH34_08840) | - | 884431..885519 (-) | 1089 | WP_011054595.1 | site-specific integrase | - |
| KUN2590_RS04720 (SPNIH34_08850) | - | 885639..885944 (-) | 306 | WP_011106738.1 | membrane protein | - |
| KUN2590_RS04725 (SPNIH34_08860) | - | 885954..886742 (-) | 789 | WP_021340822.1 | S24 family peptidase | - |
| KUN2590_RS04730 (SPNIH34_08870) | - | 887114..887260 (+) | 147 | WP_011054593.1 | hypothetical protein | - |
| KUN2590_RS04735 (SPNIH34_08890) | - | 887394..888173 (-) | 780 | WP_011054591.1 | hypothetical protein | - |
| KUN2590_RS04740 (SPNIH34_08900) | - | 888230..888436 (+) | 207 | WP_011054590.1 | hypothetical protein | - |
| KUN2590_RS04745 (SPNIH34_08910) | - | 888425..888811 (-) | 387 | WP_011054589.1 | hypothetical protein | - |
| KUN2590_RS04750 (SPNIH34_08920) | - | 888885..889124 (+) | 240 | WP_011054588.1 | helix-turn-helix domain-containing protein | - |
| KUN2590_RS04755 (SPNIH34_08940) | - | 889340..889549 (-) | 210 | WP_002984292.1 | hypothetical protein | - |
| KUN2590_RS04760 (SPNIH34_08950) | - | 889700..889939 (-) | 240 | WP_011054586.1 | hypothetical protein | - |
| KUN2590_RS04765 (SPNIH34_08960) | - | 890106..890291 (+) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| KUN2590_RS04770 (SPNIH34_08970) | - | 890369..890665 (+) | 297 | WP_011054584.1 | MerR family transcriptional regulator | - |
| KUN2590_RS09865 (SPNIH34_08980) | - | 890662..890796 (+) | 135 | WP_002995985.1 | hypothetical protein | - |
| KUN2590_RS04775 (SPNIH34_08990) | - | 890812..891126 (+) | 315 | WP_011054583.1 | helix-turn-helix transcriptional regulator | - |
| KUN2590_RS04780 (SPNIH34_09000) | - | 891355..891837 (+) | 483 | WP_011054820.1 | siphovirus Gp157 family protein | - |
| KUN2590_RS04785 (SPNIH34_09010) | - | 891838..892518 (+) | 681 | WP_002995975.1 | AAA family ATPase | - |
| KUN2590_RS04790 (SPNIH34_09020) | - | 892620..893849 (+) | 1230 | WP_011054819.1 | DEAD/DEAH box helicase | - |
| KUN2590_RS04795 (SPNIH34_09030) | - | 893865..894323 (+) | 459 | WP_011054580.1 | DUF669 domain-containing protein | - |
| KUN2590_RS04800 (SPNIH34_09040) | - | 894326..895138 (+) | 813 | WP_011106664.1 | bifunctional DNA primase/polymerase | - |
| KUN2590_RS09990 (SPNIH34_09050) | - | 895128..895682 (+) | 555 | WP_011054578.1 | hypothetical protein | - |
| KUN2590_RS04805 (SPNIH34_09060) | - | 895610..896602 (+) | 993 | WP_229309934.1 | phage/plasmid primase, P4 family | - |
| KUN2590_RS04810 (SPNIH34_09070) | - | 896865..897278 (+) | 414 | WP_008087509.1 | hypothetical protein | - |
| KUN2590_RS04815 (SPNIH34_09080) | - | 897275..897595 (+) | 321 | WP_011054576.1 | VRR-NUC domain-containing protein | - |
| KUN2590_RS04820 (SPNIH34_09090) | - | 897579..897782 (+) | 204 | WP_011054575.1 | hypothetical protein | - |
| KUN2590_RS04825 (SPNIH34_09100) | - | 897779..898063 (+) | 285 | WP_011106747.1 | hypothetical protein | - |
| KUN2590_RS04830 (SPNIH34_09110) | - | 898088..898462 (+) | 375 | WP_011054574.1 | methyltransferase domain-containing protein | - |
| KUN2590_RS04835 (SPNIH34_09130) | - | 898653..899054 (+) | 402 | WP_011054573.1 | hypothetical protein | - |
| KUN2590_RS04840 (SPNIH34_09140) | - | 899054..899689 (+) | 636 | WP_011054572.1 | N-6 DNA methylase | - |
| KUN2590_RS04845 (SPNIH34_09150) | - | 899962..900402 (+) | 441 | WP_011054571.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| KUN2590_RS04850 (SPNIH34_09170) | - | 900988..901326 (+) | 339 | WP_002985375.1 | HNH endonuclease | - |
| KUN2590_RS04855 (SPNIH34_09180) | - | 901498..901965 (+) | 468 | WP_011054569.1 | phage terminase small subunit P27 family | - |
| KUN2590_RS04860 (SPNIH34_09190) | - | 901980..903734 (+) | 1755 | WP_011054568.1 | terminase large subunit | - |
| KUN2590_RS04865 (SPNIH34_09200) | - | 903731..903901 (+) | 171 | WP_011054567.1 | hypothetical protein | - |
| KUN2590_RS04870 (SPNIH34_09210) | - | 903894..904160 (+) | 267 | WP_011054566.1 | hypothetical protein | - |
| KUN2590_RS04875 (SPNIH34_09220) | - | 904194..905414 (+) | 1221 | WP_011054565.1 | phage portal protein | - |
| KUN2590_RS04880 (SPNIH34_09230) | - | 905392..906057 (+) | 666 | WP_011054564.1 | head maturation protease, ClpP-related | - |
| KUN2590_RS04885 (SPNIH34_09240) | - | 906083..907267 (+) | 1185 | WP_011054563.1 | phage major capsid protein | - |
| KUN2590_RS09870 | - | 907281..907409 (+) | 129 | WP_011054562.1 | hypothetical protein | - |
| KUN2590_RS04890 (SPNIH34_09250) | - | 907412..907714 (+) | 303 | WP_011054561.1 | head-tail connector protein | - |
| KUN2590_RS04895 (SPNIH34_09260) | - | 907711..908049 (+) | 339 | WP_011054560.1 | phage head closure protein | - |
| KUN2590_RS04900 (SPNIH34_09270) | - | 908046..908423 (+) | 378 | WP_011054559.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| KUN2590_RS04905 (SPNIH34_09280) | - | 908420..908845 (+) | 426 | WP_011054558.1 | hypothetical protein | - |
| KUN2590_RS04910 (SPNIH34_09290) | - | 908864..909475 (+) | 612 | WP_011054557.1 | major tail protein | - |
| KUN2590_RS04915 (SPNIH34_09300) | gpG | 909528..909854 (+) | 327 | WP_011054556.1 | phage tail assembly chaperone G | - |
| KUN2590_RS04920 (SPNIH34_09310) | - | 909902..910051 (+) | 150 | WP_023609816.1 | hypothetical protein | - |
| KUN2590_RS04925 (SPNIH34_09320) | - | 910064..913987 (+) | 3924 | WP_011054554.1 | phage tail tape measure protein | - |
| KUN2590_RS04930 (SPNIH34_09330) | - | 913987..914694 (+) | 708 | WP_011054553.1 | distal tail protein Dit | - |
| KUN2590_RS04935 (SPNIH34_09340) | - | 914691..916838 (+) | 2148 | WP_023605202.1 | phage tail spike protein | - |
| KUN2590_RS04940 (SPNIH34_09350) | - | 916838..917947 (+) | 1110 | WP_023609821.1 | hyaluronidase HylP | - |
| KUN2590_RS04945 (SPNIH34_09360) | - | 917957..919975 (+) | 2019 | WP_011106754.1 | gp58-like family protein | - |
| KUN2590_RS04950 (SPNIH34_09370) | - | 919987..920418 (+) | 432 | WP_002983467.1 | DUF1617 family protein | - |
| KUN2590_RS04955 (SPNIH34_09380) | - | 920421..921038 (+) | 618 | WP_010922094.1 | DUF1366 domain-containing protein | - |
| KUN2590_RS04960 (SPNIH34_09390) | - | 921048..921323 (+) | 276 | WP_002987582.1 | hypothetical protein | - |
| KUN2590_RS04965 (SPNIH34_09400) | - | 921320..921547 (+) | 228 | WP_000609113.1 | phage holin | - |
| KUN2590_RS04970 (SPNIH34_09410) | - | 921663..922871 (+) | 1209 | WP_011054445.1 | glucosaminidase domain-containing protein | - |
| KUN2590_RS04975 (SPNIH34_09420) | - | 922987..923343 (-) | 357 | WP_011054446.1 | hypothetical protein | - |
| KUN2590_RS04980 (SPNIH34_09430) | - | 923401..923640 (-) | 240 | WP_011054447.1 | hypothetical protein | - |
| KUN2590_RS04985 (SPNIH34_09440) | - | 923904..924155 (-) | 252 | WP_011054448.1 | hypothetical protein | - |
| KUN2590_RS04990 | - | 924296..924442 (-) | 147 | WP_011054449.1 | hypothetical protein | - |
| KUN2590_RS04995 (SPNIH34_09450) | - | 924596..924805 (+) | 210 | WP_011054450.1 | helix-turn-helix domain-containing protein | - |
| KUN2590_RS05000 (SPNIH34_09460) | prx | 925004..925186 (+) | 183 | WP_029714017.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6890.90 Da Isoelectric Point: 4.1947
>NTDB_id=82682 KUN2590_RS05000 WP_029714017.1 925004..925186(+) (prx) [Streptococcus pyogenes strain NIH34]
MLTYDEFKQAIDNGYITADTVAIVRKNGLIFDYVLPHESVRSCEIVIEERVAEVMVELDK
MLTYDEFKQAIDNGYITADTVAIVRKNGLIFDYVLPHESVRSCEIVIEERVAEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=82682 KUN2590_RS05000 WP_029714017.1 925004..925186(+) (prx) [Streptococcus pyogenes strain NIH34]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTAGCGATCGTGCGTAAAAA
CGGATTGATATTTGATTATGTGTTGCCGCACGAGTCTGTGAGATCGTGTGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGATGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTAGCGATCGTGCGTAAAAA
CGGATTGATATTTGATTATGTGTTGCCGCACGAGTCTGTGAGATCGTGTGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS8232 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
70 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |