Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | KUN2590_RS04180 | Genome accession | NZ_AP023387 |
| Coordinates | 764699..764881 (+) | Length | 60 a.a. |
| NCBI ID | WP_011054671.1 | Uniprot ID | Q4VUT1 |
| Organism | Streptococcus pyogenes strain NIH34 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 728869..764881 | 764699..764881 | within | 0 |
Gene organization within MGE regions
Location: 728869..764881
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KUN2590_RS03910 (SPNIH34_07160) | - | 728887..729729 (+) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
| KUN2590_RS03915 (SPNIH34_07170) | - | 729707..730294 (+) | 588 | WP_002989129.1 | YpmS family protein | - |
| KUN2590_RS03920 (SPNIH34_07180) | - | 730393..730668 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| KUN2590_RS03925 (SPNIH34_07190) | - | 730757..731899 (-) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| KUN2590_RS03930 (SPNIH34_07200) | - | 732023..732541 (-) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| KUN2590_RS03935 (SPNIH34_07210) | - | 732553..733308 (-) | 756 | WP_010922480.1 | helix-turn-helix domain-containing protein | - |
| KUN2590_RS03940 (SPNIH34_07220) | - | 733510..733722 (+) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| KUN2590_RS03945 (SPNIH34_07230) | - | 733992..734303 (+) | 312 | WP_010922478.1 | excisionase | - |
| KUN2590_RS03950 (SPNIH34_07240) | - | 734305..734490 (+) | 186 | WP_010922477.1 | hypothetical protein | - |
| KUN2590_RS09725 (SPNIH34_07250) | - | 734584..734853 (+) | 270 | WP_011106700.1 | replication protein | - |
| KUN2590_RS03955 (SPNIH34_07260) | - | 734994..735380 (+) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| KUN2590_RS03960 (SPNIH34_07270) | - | 735361..735594 (+) | 234 | WP_010922205.1 | hypothetical protein | - |
| KUN2590_RS03965 (SPNIH34_07280) | - | 735591..735731 (+) | 141 | WP_002988354.1 | hypothetical protein | - |
| KUN2590_RS03970 (SPNIH34_07290) | - | 735740..735946 (+) | 207 | WP_002988357.1 | hypothetical protein | - |
| KUN2590_RS03975 (SPNIH34_07310) | - | 736002..736332 (+) | 331 | Protein_731 | hypothetical protein | - |
| KUN2590_RS03980 (SPNIH34_07320) | - | 736335..737261 (+) | 927 | WP_011054700.1 | recombinase RecT | - |
| KUN2590_RS03985 (SPNIH34_07330) | - | 737258..737458 (+) | 201 | WP_000594115.1 | hypothetical protein | - |
| KUN2590_RS03990 (SPNIH34_07340) | - | 737451..738248 (+) | 798 | WP_011054699.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| KUN2590_RS03995 (SPNIH34_07350) | - | 738613..739008 (+) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| KUN2590_RS04000 (SPNIH34_07360) | - | 739005..740351 (+) | 1347 | WP_011054697.1 | PcfJ domain-containing protein | - |
| KUN2590_RS04005 (SPNIH34_07370) | - | 740362..740694 (+) | 333 | WP_011054696.1 | hypothetical protein | - |
| KUN2590_RS04010 (SPNIH34_07380) | - | 740691..741203 (+) | 513 | WP_011054695.1 | hypothetical protein | - |
| KUN2590_RS04015 (SPNIH34_07390) | - | 741239..741556 (+) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| KUN2590_RS04020 (SPNIH34_07400) | - | 741553..741708 (+) | 156 | WP_011054693.1 | hypothetical protein | - |
| KUN2590_RS04025 (SPNIH34_07410) | - | 741705..741956 (+) | 252 | WP_011054692.1 | hypothetical protein | - |
| KUN2590_RS04030 (SPNIH34_07420) | - | 742032..742451 (+) | 420 | WP_011054691.1 | DUF1492 domain-containing protein | - |
| KUN2590_RS04035 (SPNIH34_07430) | - | 742559..742903 (+) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| KUN2590_RS04040 (SPNIH34_07440) | - | 743051..743407 (+) | 357 | WP_002994106.1 | hypothetical protein | - |
| KUN2590_RS04045 (SPNIH34_07450) | - | 743404..744672 (+) | 1269 | WP_010922468.1 | phage portal protein | - |
| KUN2590_RS04050 (SPNIH34_07460) | - | 744665..746158 (+) | 1494 | WP_010922467.1 | hypothetical protein | - |
| KUN2590_RS04055 (SPNIH34_07470) | - | 746164..746388 (+) | 225 | WP_002994100.1 | hypothetical protein | - |
| KUN2590_RS04060 (SPNIH34_07480) | - | 746465..746617 (+) | 153 | WP_011054687.1 | hypothetical protein | - |
| KUN2590_RS04065 (SPNIH34_07490) | - | 746610..746876 (+) | 267 | WP_002986828.1 | hypothetical protein | - |
| KUN2590_RS04070 (SPNIH34_07500) | - | 746878..747093 (+) | 216 | WP_011106704.1 | hypothetical protein | - |
| KUN2590_RS04075 (SPNIH34_07510) | - | 747175..748590 (+) | 1416 | WP_011054685.1 | terminase | - |
| KUN2590_RS04080 (SPNIH34_07520) | - | 748671..749132 (+) | 462 | WP_011054684.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| KUN2590_RS04085 (SPNIH34_07530) | - | 749157..750068 (+) | 912 | WP_011054683.1 | phage major capsid protein | - |
| KUN2590_RS04090 (SPNIH34_07540) | - | 750068..750268 (+) | 201 | WP_010922460.1 | hypothetical protein | - |
| KUN2590_RS04095 (SPNIH34_07550) | - | 750278..750700 (+) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| KUN2590_RS04100 (SPNIH34_07560) | - | 750660..750998 (+) | 339 | WP_011054681.1 | hypothetical protein | - |
| KUN2590_RS04105 (SPNIH34_07570) | - | 750991..751227 (+) | 237 | WP_000032787.1 | hypothetical protein | - |
| KUN2590_RS04110 (SPNIH34_07580) | - | 751228..751563 (+) | 336 | WP_000573598.1 | hypothetical protein | - |
| KUN2590_RS04115 (SPNIH34_07590) | - | 751579..752169 (+) | 591 | WP_011054679.1 | hypothetical protein | - |
| KUN2590_RS04120 (SPNIH34_07600) | - | 752180..752443 (+) | 264 | WP_010922455.1 | hypothetical protein | - |
| KUN2590_RS04125 (SPNIH34_07610) | - | 752458..752829 (+) | 372 | WP_011054678.1 | DUF5361 domain-containing protein | - |
| KUN2590_RS04130 (SPNIH34_07620) | - | 752829..755192 (+) | 2364 | WP_011054677.1 | hypothetical protein | - |
| KUN2590_RS04135 (SPNIH34_07630) | - | 755189..755884 (+) | 696 | WP_002992579.1 | hypothetical protein | - |
| KUN2590_RS04140 (SPNIH34_07640) | - | 755866..757839 (+) | 1974 | WP_011054676.1 | phage tail spike protein | - |
| KUN2590_RS04145 (SPNIH34_07650) | - | 757839..758948 (+) | 1110 | WP_011054675.1 | hyaluronoglucosaminidase | - |
| KUN2590_RS04150 (SPNIH34_07660) | - | 758963..760744 (+) | 1782 | WP_011054674.1 | gp58-like family protein | - |
| KUN2590_RS04155 (SPNIH34_07670) | - | 760753..761184 (+) | 432 | WP_011054673.1 | DUF1617 family protein | - |
| KUN2590_RS04160 (SPNIH34_07680) | - | 761187..761801 (+) | 615 | WP_011054672.1 | DUF1366 domain-containing protein | - |
| KUN2590_RS04165 (SPNIH34_07690) | - | 761812..762267 (+) | 456 | WP_002983475.1 | phage holin family protein | - |
| KUN2590_RS04170 (SPNIH34_07700) | - | 762379..763593 (+) | 1215 | WP_002983477.1 | peptidoglycan amidohydrolase family protein | - |
| KUN2590_RS04175 (SPNIH34_07710) | - | 763838..764632 (+) | 795 | WP_002983479.1 | DNA/RNA non-specific endonuclease | - |
| KUN2590_RS04180 (SPNIH34_07720) | prx | 764699..764881 (+) | 183 | WP_011054671.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6978.99 Da Isoelectric Point: 4.3466
>NTDB_id=82679 KUN2590_RS04180 WP_011054671.1 764699..764881(+) (prx) [Streptococcus pyogenes strain NIH34]
MLTYDEFKQAIDRGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
MLTYDEFKQAIDRGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=82679 KUN2590_RS04180 WP_011054671.1 764699..764881(+) (prx) [Streptococcus pyogenes strain NIH34]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGACCGTGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGACCGTGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
68.333 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
70 |
0.5 |