Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | KUN2590_RS03145 | Genome accession | NZ_AP023387 |
| Coordinates | 589161..589343 (+) | Length | 60 a.a. |
| NCBI ID | WP_011054793.1 | Uniprot ID | A0A5S4TJP1 |
| Organism | Streptococcus pyogenes strain NIH34 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 551375..589343 | 589161..589343 | within | 0 |
Gene organization within MGE regions
Location: 551375..589343
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KUN2590_RS02880 (SPNIH34_05070) | - | 551375..552541 (-) | 1167 | WP_009880742.1 | tyrosine-type recombinase/integrase | - |
| KUN2590_RS02885 (SPNIH34_05080) | - | 552715..553176 (-) | 462 | WP_011106661.1 | hypothetical protein | - |
| KUN2590_RS09685 (SPNIH34_05090) | - | 553200..553403 (-) | 204 | WP_197970248.1 | hypothetical protein | - |
| KUN2590_RS02890 (SPNIH34_05110) | - | 553574..553726 (-) | 153 | WP_011054825.1 | hypothetical protein | - |
| KUN2590_RS02895 (SPNIH34_05120) | - | 553737..554114 (-) | 378 | WP_011054824.1 | ImmA/IrrE family metallo-endopeptidase | - |
| KUN2590_RS02900 (SPNIH34_05130) | - | 554098..554457 (-) | 360 | WP_011054823.1 | helix-turn-helix domain-containing protein | - |
| KUN2590_RS02905 (SPNIH34_05140) | - | 554646..554864 (+) | 219 | WP_009881062.1 | helix-turn-helix domain-containing protein | - |
| KUN2590_RS02910 (SPNIH34_05150) | - | 554959..555210 (+) | 252 | WP_011054822.1 | helix-turn-helix transcriptional regulator | - |
| KUN2590_RS02915 (SPNIH34_05160) | - | 555241..555378 (+) | 138 | WP_011054821.1 | hypothetical protein | - |
| KUN2590_RS02920 (SPNIH34_05170) | - | 555394..555708 (+) | 315 | WP_011054583.1 | helix-turn-helix transcriptional regulator | - |
| KUN2590_RS02925 (SPNIH34_05180) | - | 555937..556419 (+) | 483 | WP_011054820.1 | siphovirus Gp157 family protein | - |
| KUN2590_RS02930 (SPNIH34_05190) | - | 556420..557100 (+) | 681 | WP_002995975.1 | AAA family ATPase | - |
| KUN2590_RS02935 (SPNIH34_05200) | - | 557202..558431 (+) | 1230 | WP_011054819.1 | DEAD/DEAH box helicase | - |
| KUN2590_RS02940 (SPNIH34_05210) | - | 558447..558905 (+) | 459 | WP_011054580.1 | DUF669 domain-containing protein | - |
| KUN2590_RS02945 (SPNIH34_05220) | - | 558908..559720 (+) | 813 | WP_011106664.1 | bifunctional DNA primase/polymerase | - |
| KUN2590_RS02950 (SPNIH34_05240) | - | 559710..561190 (+) | 1481 | Protein_522 | phage/plasmid primase, P4 family | - |
| KUN2590_RS02955 (SPNIH34_05250) | - | 561435..561755 (+) | 321 | WP_011054817.1 | VRR-NUC domain-containing protein | - |
| KUN2590_RS02960 (SPNIH34_05260) | - | 561739..562095 (+) | 357 | WP_011054816.1 | hypothetical protein | - |
| KUN2590_RS09920 (SPNIH34_05270) | - | 562092..562343 (+) | 252 | WP_011106665.1 | hypothetical protein | - |
| KUN2590_RS02965 (SPNIH34_05280) | - | 562337..562621 (+) | 285 | WP_011018137.1 | DUF3310 domain-containing protein | - |
| KUN2590_RS02970 (SPNIH34_05290) | - | 562618..563031 (+) | 414 | WP_011054815.1 | YopX family protein | - |
| KUN2590_RS02975 (SPNIH34_05300) | - | 563028..563198 (+) | 171 | WP_011054814.1 | hypothetical protein | - |
| KUN2590_RS02980 (SPNIH34_05310) | - | 563195..563479 (+) | 285 | WP_032461310.1 | hypothetical protein | - |
| KUN2590_RS02985 (SPNIH34_05320) | - | 563482..563817 (+) | 336 | WP_011054813.1 | hypothetical protein | - |
| KUN2590_RS02990 (SPNIH34_05330) | - | 563983..564168 (+) | 186 | WP_011054812.1 | hypothetical protein | - |
| KUN2590_RS02995 (SPNIH34_05340) | - | 564455..564958 (+) | 504 | WP_011054811.1 | DUF1642 domain-containing protein | - |
| KUN2590_RS03000 (SPNIH34_05350) | - | 564955..565125 (+) | 171 | WP_002987493.1 | hypothetical protein | - |
| KUN2590_RS03005 (SPNIH34_05360) | - | 565409..565843 (+) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| KUN2590_RS03010 (SPNIH34_05370) | - | 566453..566833 (+) | 381 | WP_011285571.1 | hypothetical protein | - |
| KUN2590_RS03015 | - | 566823..568097 (+) | 1275 | Protein_536 | PBSX family phage terminase large subunit | - |
| KUN2590_RS03020 (SPNIH34_05400) | - | 568097..569422 (+) | 1326 | WP_032461413.1 | phage portal protein | - |
| KUN2590_RS03025 (SPNIH34_05410) | - | 569391..570299 (+) | 909 | WP_009880264.1 | minor capsid protein | - |
| KUN2590_RS03030 (SPNIH34_05420) | - | 570306..570572 (+) | 267 | WP_011054805.1 | hypothetical protein | - |
| KUN2590_RS03035 (SPNIH34_05430) | - | 570722..571294 (+) | 573 | WP_011054804.1 | DUF4355 domain-containing protein | - |
| KUN2590_RS03040 (SPNIH34_05440) | - | 571312..572202 (+) | 891 | WP_009880261.1 | hypothetical protein | - |
| KUN2590_RS03045 (SPNIH34_05450) | - | 572215..572508 (+) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| KUN2590_RS03050 (SPNIH34_05460) | - | 572522..572866 (+) | 345 | WP_009880259.1 | hypothetical protein | - |
| KUN2590_RS03055 (SPNIH34_05470) | - | 572863..573174 (+) | 312 | WP_009880258.1 | hypothetical protein | - |
| KUN2590_RS03060 (SPNIH34_05480) | - | 573171..573566 (+) | 396 | WP_009880257.1 | hypothetical protein | - |
| KUN2590_RS03065 (SPNIH34_05490) | - | 573568..573978 (+) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| KUN2590_RS03070 (SPNIH34_05500) | - | 573990..574496 (+) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| KUN2590_RS03075 (SPNIH34_05510) | - | 574509..574826 (+) | 318 | WP_009880254.1 | hypothetical protein | - |
| KUN2590_RS03080 (SPNIH34_05520) | - | 574799..575257 (+) | 459 | WP_009880253.1 | hypothetical protein | - |
| KUN2590_RS03085 (SPNIH34_05530) | - | 575250..577055 (+) | 1806 | WP_011054802.1 | tail protein | - |
| KUN2590_RS03090 (SPNIH34_05540) | - | 577056..578540 (+) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| KUN2590_RS03095 (SPNIH34_05550) | - | 578541..581981 (+) | 3441 | WP_011054801.1 | glucosaminidase domain-containing protein | - |
| KUN2590_RS03100 (SPNIH34_05560) | - | 581986..583848 (+) | 1863 | WP_011106671.1 | DUF859 family phage minor structural protein | - |
| KUN2590_RS03105 (SPNIH34_05570) | - | 583859..584206 (+) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| KUN2590_RS09855 (SPNIH34_05580) | - | 584220..584342 (+) | 123 | WP_015055953.1 | hypothetical protein | - |
| KUN2590_RS03110 (SPNIH34_05600) | - | 584678..585010 (+) | 333 | WP_011054798.1 | phage holin | - |
| KUN2590_RS03115 (SPNIH34_05610) | - | 585012..585776 (+) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| KUN2590_RS03120 (SPNIH34_05620) | - | 585788..586390 (+) | 603 | WP_011054796.1 | hypothetical protein | - |
| KUN2590_RS03125 (SPNIH34_05630) | - | 586401..587174 (+) | 774 | WP_011054795.1 | hypothetical protein | - |
| KUN2590_RS03130 (SPNIH34_05640) | - | 587184..587405 (+) | 222 | WP_009880241.1 | hypothetical protein | - |
| KUN2590_RS03135 (SPNIH34_05650) | - | 587405..588064 (+) | 660 | WP_009880240.1 | hypothetical protein | - |
| KUN2590_RS03140 (SPNIH34_05660) | speA | 588186..588941 (-) | 756 | WP_011054794.1 | streptococcal pyrogenic exotoxin SpeA | - |
| KUN2590_RS03145 (SPNIH34_05670) | prx | 589161..589343 (+) | 183 | WP_011054793.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7014.08 Da Isoelectric Point: 4.3313
>NTDB_id=82674 KUN2590_RS03145 WP_011054793.1 589161..589343(+) (prx) [Streptococcus pyogenes strain NIH34]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=82674 KUN2590_RS03145 WP_011054793.1 589161..589343(+) (prx) [Streptococcus pyogenes strain NIH34]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS8232 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
68.333 |
100 |
0.683 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |