Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | KUN2590_RS02560 | Genome accession | NZ_AP023387 |
| Coordinates | 491717..491899 (+) | Length | 60 a.a. |
| NCBI ID | WP_011054856.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NIH34 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 446316..491899 | 491717..491899 | within | 0 |
Gene organization within MGE regions
Location: 446316..491899
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KUN2590_RS02295 (SPNIH34_03990) | fsa | 446316..446960 (+) | 645 | WP_002983569.1 | fructose-6-phosphate aldolase | - |
| KUN2590_RS02300 (SPNIH34_04000) | tkt | 447178..449163 (+) | 1986 | WP_011054904.1 | transketolase | - |
| KUN2590_RS02305 (SPNIH34_04010) | - | 449356..449580 (+) | 225 | WP_011054903.1 | bacteriocin immunity protein | - |
| KUN2590_RS02310 (SPNIH34_04020) | - | 449656..450390 (+) | 735 | WP_011054902.1 | ABC transporter ATP-binding protein | - |
| KUN2590_RS02315 (SPNIH34_04030) | - | 450395..452023 (+) | 1629 | WP_011054901.1 | ABC transporter permease | - |
| KUN2590_RS02320 (SPNIH34_04040) | - | 452166..453254 (-) | 1089 | WP_011054900.1 | site-specific integrase | - |
| KUN2590_RS02325 (SPNIH34_04050) | - | 453430..453981 (-) | 552 | WP_011054899.1 | hypothetical protein | - |
| KUN2590_RS02330 (SPNIH34_04060) | - | 453992..454375 (-) | 384 | WP_011054898.1 | ImmA/IrrE family metallo-endopeptidase | - |
| KUN2590_RS02335 (SPNIH34_04070) | - | 454389..454739 (-) | 351 | WP_011184049.1 | helix-turn-helix domain-containing protein | - |
| KUN2590_RS02340 (SPNIH34_04080) | - | 455378..455569 (+) | 192 | WP_001283052.1 | hypothetical protein | - |
| KUN2590_RS02345 (SPNIH34_04090) | - | 455620..455820 (+) | 201 | WP_011184050.1 | hypothetical protein | - |
| KUN2590_RS02350 (SPNIH34_04100) | - | 455908..456165 (+) | 258 | WP_011054895.1 | hypothetical protein | - |
| KUN2590_RS02355 (SPNIH34_04110) | - | 456194..456364 (+) | 171 | WP_011054894.1 | hypothetical protein | - |
| KUN2590_RS02360 (SPNIH34_04120) | - | 456357..456564 (+) | 208 | Protein_415 | hypothetical protein | - |
| KUN2590_RS02365 (SPNIH34_04130) | - | 456561..456944 (+) | 384 | WP_011054892.1 | hypothetical protein | - |
| KUN2590_RS02370 (SPNIH34_04150) | - | 457090..457293 (+) | 204 | WP_011054890.1 | hypothetical protein | - |
| KUN2590_RS02375 (SPNIH34_04160) | - | 457381..457680 (+) | 300 | WP_000573833.1 | hypothetical protein | - |
| KUN2590_RS02380 (SPNIH34_04170) | - | 457680..458837 (+) | 1158 | WP_011054889.1 | DUF2800 domain-containing protein | - |
| KUN2590_RS02385 (SPNIH34_04180) | - | 458851..459414 (+) | 564 | WP_011054888.1 | DUF2815 family protein | - |
| KUN2590_RS02390 (SPNIH34_04190) | - | 459457..461379 (+) | 1923 | WP_011054887.1 | DNA polymerase | - |
| KUN2590_RS02395 (SPNIH34_04200) | - | 461384..463768 (+) | 2385 | WP_011054886.1 | phage/plasmid primase, P4 family | - |
| KUN2590_RS02400 (SPNIH34_04210) | - | 464134..464409 (+) | 276 | WP_011054885.1 | VRR-NUC domain-containing protein | - |
| KUN2590_RS02405 (SPNIH34_04220) | - | 464406..465728 (+) | 1323 | WP_011054884.1 | SNF2-related protein | - |
| KUN2590_RS02410 (SPNIH34_04230) | - | 465729..465899 (+) | 171 | WP_011054883.1 | hypothetical protein | - |
| KUN2590_RS02415 (SPNIH34_04240) | - | 465892..466164 (+) | 273 | WP_011054882.1 | hypothetical protein | - |
| KUN2590_RS02420 (SPNIH34_04260) | - | 466297..466713 (+) | 417 | WP_011054881.1 | transcriptional regulator | - |
| KUN2590_RS02425 (SPNIH34_04270) | - | 466803..467255 (+) | 453 | WP_011106637.1 | terminase small subunit | - |
| KUN2590_RS02430 (SPNIH34_04280) | - | 467245..468522 (+) | 1278 | WP_011054879.1 | PBSX family phage terminase large subunit | - |
| KUN2590_RS02435 (SPNIH34_04290) | - | 468538..470070 (+) | 1533 | WP_011106638.1 | phage portal protein | - |
| KUN2590_RS02440 (SPNIH34_04300) | - | 470030..471478 (+) | 1449 | WP_011054877.1 | minor capsid protein | - |
| KUN2590_RS02445 (SPNIH34_04310) | - | 471506..471694 (+) | 189 | WP_011054876.1 | hypothetical protein | - |
| KUN2590_RS02450 (SPNIH34_04320) | - | 471699..471965 (+) | 267 | WP_011054875.1 | hypothetical protein | - |
| KUN2590_RS02455 (SPNIH34_04330) | - | 472133..472702 (+) | 570 | WP_011054874.1 | DUF4355 domain-containing protein | - |
| KUN2590_RS02460 (SPNIH34_04340) | - | 472715..473602 (+) | 888 | WP_002983429.1 | hypothetical protein | - |
| KUN2590_RS02465 (SPNIH34_04350) | - | 473614..473970 (+) | 357 | WP_011054873.1 | phage head-tail connector protein | - |
| KUN2590_RS02470 (SPNIH34_04360) | - | 473981..474259 (+) | 279 | WP_011054872.1 | hypothetical protein | - |
| KUN2590_RS02475 (SPNIH34_04370) | - | 474256..474600 (+) | 345 | WP_011106640.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| KUN2590_RS02480 (SPNIH34_04380) | - | 474604..474963 (+) | 360 | WP_011054870.1 | hypothetical protein | - |
| KUN2590_RS02485 (SPNIH34_04390) | - | 474975..475574 (+) | 600 | WP_011054869.1 | phage major tail protein, TP901-1 family | - |
| KUN2590_RS02490 (SPNIH34_04400) | - | 475628..476083 (+) | 456 | WP_011054868.1 | tail assembly chaperone | - |
| KUN2590_RS02495 (SPNIH34_04410) | - | 476158..476391 (+) | 234 | WP_011054867.1 | hypothetical protein | - |
| KUN2590_RS02500 (SPNIH34_04420) | - | 476406..480788 (+) | 4383 | WP_011054866.1 | tape measure protein | - |
| KUN2590_RS02505 (SPNIH34_04430) | - | 480800..481642 (+) | 843 | WP_011054865.1 | phage tail family protein | - |
| KUN2590_RS02510 (SPNIH34_04440) | - | 481652..483631 (+) | 1980 | WP_011054864.1 | phage tail protein | - |
| KUN2590_RS02515 (SPNIH34_04450) | - | 483628..484635 (+) | 1008 | WP_011054441.1 | hyaluronoglucosaminidase | - |
| KUN2590_RS02520 (SPNIH34_04460) | - | 484645..486660 (+) | 2016 | WP_032461307.1 | gp58-like family protein | - |
| KUN2590_RS02525 (SPNIH34_04470) | - | 486672..487109 (+) | 438 | WP_011106643.1 | DUF1617 family protein | - |
| KUN2590_RS02530 (SPNIH34_04480) | - | 487106..487723 (+) | 618 | WP_011184056.1 | DUF1366 domain-containing protein | - |
| KUN2590_RS02535 (SPNIH34_04490) | - | 487733..488005 (+) | 273 | WP_002986916.1 | hypothetical protein | - |
| KUN2590_RS02540 (SPNIH34_04500) | - | 488002..488229 (+) | 228 | WP_003058873.1 | phage holin | - |
| KUN2590_RS02545 (SPNIH34_04510) | - | 488345..489547 (+) | 1203 | WP_011184057.1 | glucosaminidase domain-containing protein | - |
| KUN2590_RS02550 (SPNIH34_04520) | - | 489869..490384 (+) | 516 | WP_023077389.1 | hypothetical protein | - |
| KUN2590_RS02555 (SPNIH34_04530) | - | 490498..491484 (-) | 987 | WP_011106647.1 | DNA/RNA non-specific endonuclease | - |
| KUN2590_RS02560 (SPNIH34_04540) | prx | 491717..491899 (+) | 183 | WP_011054856.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6927.67 Da Isoelectric Point: 3.9286
>NTDB_id=82670 KUN2590_RS02560 WP_011054856.1 491717..491899(+) (prx) [Streptococcus pyogenes strain NIH34]
MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYALPNEEVRNGEVVTYENVEEVLRELDK
MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYALPNEEVRNGEVVTYENVEEVLRELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=82670 KUN2590_RS02560 WP_011054856.1 491717..491899(+) (prx) [Streptococcus pyogenes strain NIH34]
ATGCTAACATACGATGAGTTTAAGCAAGCTATTGATGACGGATATATCACAGGCGACACAGTGGCGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGCGTTGCCGAATGAAGAGGTAAGAAATGGGGAGGTTGTAACATACGAAAATGTGGAAGAAG
TGCTGAGGGAATTAGACAAATAA
ATGCTAACATACGATGAGTTTAAGCAAGCTATTGATGACGGATATATCACAGGCGACACAGTGGCGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGCGTTGCCGAATGAAGAGGTAAGAAATGGGGAGGTTGTAACATACGAAAATGTGGAAGAAG
TGCTGAGGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS8232 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
88.372 |
71.667 |
0.633 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |