Detailed information    

insolico Bioinformatically predicted

Overview


Name   prx   Type   Regulator
Locus tag   P8191_RS02020 Genome accession   NZ_CP121250
Coordinates   373630..373818 (+) Length   62 a.a.
NCBI ID   WP_011285559.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain 1044     
Function   Inhibit ComR activation (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 334137..375935 373630..373818 within 0


Gene organization within MGE regions


Location: 334137..375935
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P8191_RS01710 (P8191_01710) - 334137..334757 (-) 621 WP_002989605.1 DUF3862 domain-containing protein -
  P8191_RS01715 (P8191_01715) - 335120..336208 (-) 1089 WP_011054595.1 site-specific integrase -
  P8191_RS01720 (P8191_01720) - 336329..337222 (-) 894 WP_011285585.1 P63C domain-containing protein -
  P8191_RS01725 (P8191_01725) - 337258..338082 (-) 825 WP_011285584.1 helix-turn-helix transcriptional regulator -
  P8191_RS01730 (P8191_01730) - 338439..338597 (+) 159 WP_011285583.1 hypothetical protein -
  P8191_RS01735 (P8191_01735) - 338627..339226 (-) 600 WP_011284882.1 hypothetical protein -
  P8191_RS01740 (P8191_01740) - 339280..339489 (+) 210 WP_011284881.1 hypothetical protein -
  P8191_RS01745 (P8191_01745) - 339478..339864 (-) 387 WP_011054589.1 hypothetical protein -
  P8191_RS01750 (P8191_01750) - 339938..340138 (+) 201 WP_002992770.1 helix-turn-helix transcriptional regulator -
  P8191_RS01755 (P8191_01755) - 340248..340457 (-) 210 WP_011017885.1 hypothetical protein -
  P8191_RS01760 (P8191_01760) - 340588..341097 (-) 510 WP_011017884.1 hypothetical protein -
  P8191_RS01765 (P8191_01765) - 341152..341415 (+) 264 WP_029714276.1 hypothetical protein -
  P8191_RS01770 (P8191_01770) - 341452..341748 (+) 297 WP_011054584.1 MerR family transcriptional regulator -
  P8191_RS01775 (P8191_01775) - 341745..341879 (+) 135 WP_002995985.1 hypothetical protein -
  P8191_RS01780 (P8191_01780) - 341895..342209 (+) 315 WP_023610888.1 helix-turn-helix transcriptional regulator -
  P8191_RS01785 (P8191_01785) - 342223..343053 (+) 831 WP_009881060.1 phage replisome organizer N-terminal domain-containing protein -
  P8191_RS01790 (P8191_01790) - 343040..343822 (+) 783 WP_011285581.1 ATP-binding protein -
  P8191_RS01795 (P8191_01795) - 343963..344316 (+) 354 WP_011285579.1 hypothetical protein -
  P8191_RS01800 (P8191_01800) - 344297..344551 (+) 255 WP_011018143.1 hypothetical protein -
  P8191_RS01805 (P8191_01805) - 344573..345055 (+) 483 WP_011018142.1 siphovirus Gp157 family protein -
  P8191_RS01810 (P8191_01810) - 345056..345730 (+) 675 WP_046735269.1 ERF family protein -
  P8191_RS01815 (P8191_01815) ssb 345723..346148 (+) 426 WP_011285575.1 single-stranded DNA-binding protein Machinery gene
  P8191_RS01820 (P8191_01820) - 346154..346357 (+) 204 WP_011106686.1 hypothetical protein -
  P8191_RS01825 (P8191_01825) - 346357..346797 (+) 441 WP_011285574.1 RusA family crossover junction endodeoxyribonuclease -
  P8191_RS01830 (P8191_01830) - 346794..347150 (+) 357 WP_011284873.1 hypothetical protein -
  P8191_RS10360 - 347147..347392 (+) 246 WP_011285573.1 hypothetical protein -
  P8191_RS01835 (P8191_01835) - 347392..347628 (+) 237 WP_002995955.1 DUF3310 domain-containing protein -
  P8191_RS01840 (P8191_01840) - 347625..347795 (+) 171 WP_002995952.1 hypothetical protein -
  P8191_RS01845 (P8191_01845) - 347792..348076 (+) 285 WP_011018134.1 hypothetical protein -
  P8191_RS01850 (P8191_01850) - 348078..348710 (+) 633 WP_011018133.1 N-6 DNA methylase -
  P8191_RS01855 (P8191_01855) - 348713..349237 (+) 525 WP_011285572.1 DUF1642 domain-containing protein -
  P8191_RS01860 (P8191_01860) - 349234..349500 (+) 267 WP_011018131.1 hypothetical protein -
  P8191_RS01865 (P8191_01865) - 349786..350220 (+) 435 WP_011054810.1 ArpU family phage packaging/lysis transcriptional regulator -
  P8191_RS01870 (P8191_01870) - 350830..351210 (+) 381 WP_011285571.1 hypothetical protein -
  P8191_RS01875 (P8191_01875) - 351200..352474 (+) 1275 WP_009880266.1 PBSX family phage terminase large subunit -
  P8191_RS01880 (P8191_01880) - 352474..353799 (+) 1326 WP_029714009.1 phage portal protein -
  P8191_RS01885 (P8191_01885) - 353768..354676 (+) 909 WP_011285569.1 minor capsid protein -
  P8191_RS01890 (P8191_01890) - 354683..354952 (+) 270 WP_011285568.1 hypothetical protein -
  P8191_RS01895 (P8191_01895) - 354954..355088 (+) 135 WP_015055956.1 hypothetical protein -
  P8191_RS01900 (P8191_01900) - 355197..355766 (+) 570 WP_009880262.1 DUF4355 domain-containing protein -
  P8191_RS01905 (P8191_01905) - 355785..356675 (+) 891 WP_009880261.1 hypothetical protein -
  P8191_RS01910 (P8191_01910) - 356688..356981 (+) 294 WP_009880260.1 HeH/LEM domain-containing protein -
  P8191_RS01915 (P8191_01915) - 356995..357333 (+) 339 WP_029714010.1 hypothetical protein -
  P8191_RS01920 (P8191_01920) - 357330..357641 (+) 312 WP_011285567.1 hypothetical protein -
  P8191_RS01925 (P8191_01925) - 357638..358033 (+) 396 WP_009880257.1 hypothetical protein -
  P8191_RS01930 (P8191_01930) - 358035..358445 (+) 411 WP_009880256.1 DUF5072 family protein -
  P8191_RS01935 (P8191_01935) - 358457..358963 (+) 507 WP_009880255.1 phage major tail protein, TP901-1 family -
  P8191_RS01940 (P8191_01940) - 358976..359293 (+) 318 WP_009880254.1 hypothetical protein -
  P8191_RS01945 (P8191_01945) - 359266..359724 (+) 459 WP_009880253.1 hypothetical protein -
  P8191_RS01950 (P8191_01950) - 359717..361522 (+) 1806 WP_011054802.1 tail protein -
  P8191_RS01955 (P8191_01955) - 361523..363007 (+) 1485 WP_009880250.1 distal tail protein Dit -
  P8191_RS01960 (P8191_01960) - 363008..366448 (+) 3441 WP_011285566.1 glucosaminidase domain-containing protein -
  P8191_RS01965 (P8191_01965) - 366453..368315 (+) 1863 WP_015055954.1 DUF859 family phage minor structural protein -
  P8191_RS01970 (P8191_01970) - 368326..368673 (+) 348 WP_011285564.1 DUF1366 domain-containing protein -
  P8191_RS01975 (P8191_01975) - 368687..368809 (+) 123 WP_015055953.1 hypothetical protein -
  P8191_RS01980 (P8191_01980) - 368823..369146 (+) 324 WP_015055952.1 hypothetical protein -
  P8191_RS01985 (P8191_01985) - 369146..369478 (+) 333 WP_011285562.1 phage holin -
  P8191_RS01990 (P8191_01990) - 369480..370244 (+) 765 WP_011285561.1 CHAP domain-containing protein -
  P8191_RS01995 (P8191_01995) - 370256..370858 (+) 603 WP_011054796.1 hypothetical protein -
  P8191_RS02000 (P8191_02000) - 370869..371642 (+) 774 WP_011054795.1 hypothetical protein -
  P8191_RS02005 (P8191_02005) - 371652..371873 (+) 222 WP_009880241.1 hypothetical protein -
  P8191_RS02010 (P8191_02010) - 371873..372532 (+) 660 WP_009880240.1 hypothetical protein -
  P8191_RS02015 (P8191_02015) speA 372654..373409 (-) 756 WP_009880239.1 streptococcal pyrogenic exotoxin SpeA -
  P8191_RS02020 (P8191_02020) prx 373630..373818 (+) 189 WP_011285559.1 hypothetical protein Regulator
  P8191_RS02030 (P8191_02030) - 374409..375023 (+) 615 WP_011285558.1 TVP38/TMEM64 family protein -
  P8191_RS02035 (P8191_02035) - 375150..375935 (-) 786 WP_010922378.1 hypothetical protein -

Sequence


Protein


Download         Length: 62 a.a.        Molecular weight: 7290.41 Da        Isoelectric Point: 4.3313

>NTDB_id=811318 P8191_RS02020 WP_011285559.1 373630..373818(+) (prx) [Streptococcus pyogenes strain 1044]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK

Nucleotide


Download         Length: 189 bp        

>NTDB_id=811318 P8191_RS02020 WP_011285559.1 373630..373818(+) (prx) [Streptococcus pyogenes strain 1044]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  prx Streptococcus pyogenes MGAS315

100

95.161

0.952

  prx Streptococcus pyogenes MGAS315

79.032

100

0.79

  prx Streptococcus pyogenes MGAS8232

76.271

95.161

0.726

  prx Streptococcus pyogenes MGAS315

76.271

95.161

0.726

  prx Streptococcus pyogenes MGAS315

74.576

95.161

0.71

  prx Streptococcus pyogenes MGAS315

69.492

95.161

0.661

  prx Streptococcus pyogenes MGAS315

82.927

66.129

0.548