Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | P8191_RS02020 | Genome accession | NZ_CP121250 |
| Coordinates | 373630..373818 (+) | Length | 62 a.a. |
| NCBI ID | WP_011285559.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain 1044 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 334137..375935 | 373630..373818 | within | 0 |
Gene organization within MGE regions
Location: 334137..375935
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8191_RS01710 (P8191_01710) | - | 334137..334757 (-) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
| P8191_RS01715 (P8191_01715) | - | 335120..336208 (-) | 1089 | WP_011054595.1 | site-specific integrase | - |
| P8191_RS01720 (P8191_01720) | - | 336329..337222 (-) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| P8191_RS01725 (P8191_01725) | - | 337258..338082 (-) | 825 | WP_011285584.1 | helix-turn-helix transcriptional regulator | - |
| P8191_RS01730 (P8191_01730) | - | 338439..338597 (+) | 159 | WP_011285583.1 | hypothetical protein | - |
| P8191_RS01735 (P8191_01735) | - | 338627..339226 (-) | 600 | WP_011284882.1 | hypothetical protein | - |
| P8191_RS01740 (P8191_01740) | - | 339280..339489 (+) | 210 | WP_011284881.1 | hypothetical protein | - |
| P8191_RS01745 (P8191_01745) | - | 339478..339864 (-) | 387 | WP_011054589.1 | hypothetical protein | - |
| P8191_RS01750 (P8191_01750) | - | 339938..340138 (+) | 201 | WP_002992770.1 | helix-turn-helix transcriptional regulator | - |
| P8191_RS01755 (P8191_01755) | - | 340248..340457 (-) | 210 | WP_011017885.1 | hypothetical protein | - |
| P8191_RS01760 (P8191_01760) | - | 340588..341097 (-) | 510 | WP_011017884.1 | hypothetical protein | - |
| P8191_RS01765 (P8191_01765) | - | 341152..341415 (+) | 264 | WP_029714276.1 | hypothetical protein | - |
| P8191_RS01770 (P8191_01770) | - | 341452..341748 (+) | 297 | WP_011054584.1 | MerR family transcriptional regulator | - |
| P8191_RS01775 (P8191_01775) | - | 341745..341879 (+) | 135 | WP_002995985.1 | hypothetical protein | - |
| P8191_RS01780 (P8191_01780) | - | 341895..342209 (+) | 315 | WP_023610888.1 | helix-turn-helix transcriptional regulator | - |
| P8191_RS01785 (P8191_01785) | - | 342223..343053 (+) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| P8191_RS01790 (P8191_01790) | - | 343040..343822 (+) | 783 | WP_011285581.1 | ATP-binding protein | - |
| P8191_RS01795 (P8191_01795) | - | 343963..344316 (+) | 354 | WP_011285579.1 | hypothetical protein | - |
| P8191_RS01800 (P8191_01800) | - | 344297..344551 (+) | 255 | WP_011018143.1 | hypothetical protein | - |
| P8191_RS01805 (P8191_01805) | - | 344573..345055 (+) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| P8191_RS01810 (P8191_01810) | - | 345056..345730 (+) | 675 | WP_046735269.1 | ERF family protein | - |
| P8191_RS01815 (P8191_01815) | ssb | 345723..346148 (+) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| P8191_RS01820 (P8191_01820) | - | 346154..346357 (+) | 204 | WP_011106686.1 | hypothetical protein | - |
| P8191_RS01825 (P8191_01825) | - | 346357..346797 (+) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| P8191_RS01830 (P8191_01830) | - | 346794..347150 (+) | 357 | WP_011284873.1 | hypothetical protein | - |
| P8191_RS10360 | - | 347147..347392 (+) | 246 | WP_011285573.1 | hypothetical protein | - |
| P8191_RS01835 (P8191_01835) | - | 347392..347628 (+) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| P8191_RS01840 (P8191_01840) | - | 347625..347795 (+) | 171 | WP_002995952.1 | hypothetical protein | - |
| P8191_RS01845 (P8191_01845) | - | 347792..348076 (+) | 285 | WP_011018134.1 | hypothetical protein | - |
| P8191_RS01850 (P8191_01850) | - | 348078..348710 (+) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| P8191_RS01855 (P8191_01855) | - | 348713..349237 (+) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| P8191_RS01860 (P8191_01860) | - | 349234..349500 (+) | 267 | WP_011018131.1 | hypothetical protein | - |
| P8191_RS01865 (P8191_01865) | - | 349786..350220 (+) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| P8191_RS01870 (P8191_01870) | - | 350830..351210 (+) | 381 | WP_011285571.1 | hypothetical protein | - |
| P8191_RS01875 (P8191_01875) | - | 351200..352474 (+) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| P8191_RS01880 (P8191_01880) | - | 352474..353799 (+) | 1326 | WP_029714009.1 | phage portal protein | - |
| P8191_RS01885 (P8191_01885) | - | 353768..354676 (+) | 909 | WP_011285569.1 | minor capsid protein | - |
| P8191_RS01890 (P8191_01890) | - | 354683..354952 (+) | 270 | WP_011285568.1 | hypothetical protein | - |
| P8191_RS01895 (P8191_01895) | - | 354954..355088 (+) | 135 | WP_015055956.1 | hypothetical protein | - |
| P8191_RS01900 (P8191_01900) | - | 355197..355766 (+) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| P8191_RS01905 (P8191_01905) | - | 355785..356675 (+) | 891 | WP_009880261.1 | hypothetical protein | - |
| P8191_RS01910 (P8191_01910) | - | 356688..356981 (+) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| P8191_RS01915 (P8191_01915) | - | 356995..357333 (+) | 339 | WP_029714010.1 | hypothetical protein | - |
| P8191_RS01920 (P8191_01920) | - | 357330..357641 (+) | 312 | WP_011285567.1 | hypothetical protein | - |
| P8191_RS01925 (P8191_01925) | - | 357638..358033 (+) | 396 | WP_009880257.1 | hypothetical protein | - |
| P8191_RS01930 (P8191_01930) | - | 358035..358445 (+) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| P8191_RS01935 (P8191_01935) | - | 358457..358963 (+) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| P8191_RS01940 (P8191_01940) | - | 358976..359293 (+) | 318 | WP_009880254.1 | hypothetical protein | - |
| P8191_RS01945 (P8191_01945) | - | 359266..359724 (+) | 459 | WP_009880253.1 | hypothetical protein | - |
| P8191_RS01950 (P8191_01950) | - | 359717..361522 (+) | 1806 | WP_011054802.1 | tail protein | - |
| P8191_RS01955 (P8191_01955) | - | 361523..363007 (+) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| P8191_RS01960 (P8191_01960) | - | 363008..366448 (+) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| P8191_RS01965 (P8191_01965) | - | 366453..368315 (+) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| P8191_RS01970 (P8191_01970) | - | 368326..368673 (+) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| P8191_RS01975 (P8191_01975) | - | 368687..368809 (+) | 123 | WP_015055953.1 | hypothetical protein | - |
| P8191_RS01980 (P8191_01980) | - | 368823..369146 (+) | 324 | WP_015055952.1 | hypothetical protein | - |
| P8191_RS01985 (P8191_01985) | - | 369146..369478 (+) | 333 | WP_011285562.1 | phage holin | - |
| P8191_RS01990 (P8191_01990) | - | 369480..370244 (+) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| P8191_RS01995 (P8191_01995) | - | 370256..370858 (+) | 603 | WP_011054796.1 | hypothetical protein | - |
| P8191_RS02000 (P8191_02000) | - | 370869..371642 (+) | 774 | WP_011054795.1 | hypothetical protein | - |
| P8191_RS02005 (P8191_02005) | - | 371652..371873 (+) | 222 | WP_009880241.1 | hypothetical protein | - |
| P8191_RS02010 (P8191_02010) | - | 371873..372532 (+) | 660 | WP_009880240.1 | hypothetical protein | - |
| P8191_RS02015 (P8191_02015) | speA | 372654..373409 (-) | 756 | WP_009880239.1 | streptococcal pyrogenic exotoxin SpeA | - |
| P8191_RS02020 (P8191_02020) | prx | 373630..373818 (+) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| P8191_RS02030 (P8191_02030) | - | 374409..375023 (+) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| P8191_RS02035 (P8191_02035) | - | 375150..375935 (-) | 786 | WP_010922378.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7290.41 Da Isoelectric Point: 4.3313
>NTDB_id=811318 P8191_RS02020 WP_011285559.1 373630..373818(+) (prx) [Streptococcus pyogenes strain 1044]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=811318 P8191_RS02020 WP_011285559.1 373630..373818(+) (prx) [Streptococcus pyogenes strain 1044]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
95.161 |
0.952 |
| prx | Streptococcus pyogenes MGAS315 |
79.032 |
100 |
0.79 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
95.161 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
95.161 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
66.129 |
0.548 |