Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | P8191_RS01170 | Genome accession | NZ_CP121250 |
| Coordinates | 210941..211123 (+) | Length | 60 a.a. |
| NCBI ID | WP_029714291.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain 1044 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 176181..211123 | 210941..211123 | within | 0 |
Gene organization within MGE regions
Location: 176181..211123
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8191_RS00905 (P8191_00905) | - | 176199..177041 (+) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
| P8191_RS00910 (P8191_00910) | - | 177019..177606 (+) | 588 | WP_010922482.1 | YpmS family protein | - |
| P8191_RS00915 (P8191_00915) | - | 177705..177980 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| P8191_RS00920 (P8191_00920) | - | 178069..179211 (-) | 1143 | WP_003051793.1 | site-specific integrase | - |
| P8191_RS00925 (P8191_00925) | - | 179335..179853 (-) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| P8191_RS00930 (P8191_00930) | - | 179865..180620 (-) | 756 | WP_010922480.1 | XRE family transcriptional regulator | - |
| P8191_RS00935 (P8191_00935) | - | 180821..181033 (+) | 213 | WP_010922479.1 | helix-turn-helix transcriptional regulator | - |
| P8191_RS00940 (P8191_00940) | - | 181303..181614 (+) | 312 | WP_010922478.1 | excisionase | - |
| P8191_RS00945 (P8191_00945) | - | 181616..181801 (+) | 186 | WP_010922477.1 | hypothetical protein | - |
| P8191_RS00950 (P8191_00950) | - | 181895..182164 (+) | 270 | WP_011106700.1 | replication protein | - |
| P8191_RS00955 (P8191_00955) | - | 182305..182691 (+) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| P8191_RS00960 (P8191_00960) | - | 182672..182905 (+) | 234 | WP_002985387.1 | hypothetical protein | - |
| P8191_RS00965 (P8191_00965) | - | 182902..183042 (+) | 141 | WP_011017992.1 | hypothetical protein | - |
| P8191_RS00970 (P8191_00970) | - | 183051..183257 (+) | 207 | WP_011017565.1 | hypothetical protein | - |
| P8191_RS00975 (P8191_00975) | - | 183313..183642 (+) | 330 | WP_002988359.1 | hypothetical protein | - |
| P8191_RS00980 (P8191_00980) | - | 183645..184574 (+) | 930 | WP_011285626.1 | recombinase RecT | - |
| P8191_RS00985 (P8191_00985) | - | 184571..185368 (+) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| P8191_RS00990 (P8191_00990) | - | 185378..185545 (+) | 168 | WP_011285624.1 | hypothetical protein | - |
| P8191_RS00995 (P8191_00995) | - | 185723..186064 (+) | 342 | WP_020837403.1 | hypothetical protein | - |
| P8191_RS01000 (P8191_01000) | - | 186061..186573 (+) | 513 | WP_002988366.1 | hypothetical protein | - |
| P8191_RS01005 (P8191_01005) | - | 186657..186926 (+) | 270 | WP_002988369.1 | hypothetical protein | - |
| P8191_RS01010 (P8191_01010) | - | 186928..187563 (+) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| P8191_RS01015 (P8191_01015) | - | 187831..188250 (+) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| P8191_RS01020 (P8191_01020) | - | 188359..188703 (+) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| P8191_RS01025 (P8191_01025) | - | 188852..189208 (+) | 357 | WP_002994106.1 | hypothetical protein | - |
| P8191_RS01030 (P8191_01030) | - | 189205..190473 (+) | 1269 | WP_010922468.1 | phage portal protein | - |
| P8191_RS01035 (P8191_01035) | - | 190466..191959 (+) | 1494 | WP_010922467.1 | hypothetical protein | - |
| P8191_RS01040 (P8191_01040) | - | 191965..192189 (+) | 225 | WP_010922466.1 | hypothetical protein | - |
| P8191_RS01045 (P8191_01045) | - | 192239..192418 (+) | 180 | WP_015055972.1 | hypothetical protein | - |
| P8191_RS01050 (P8191_01050) | - | 192411..192677 (+) | 267 | WP_010922464.1 | hypothetical protein | - |
| P8191_RS01055 (P8191_01055) | - | 192787..194202 (+) | 1416 | WP_011285619.1 | terminase | - |
| P8191_RS01060 (P8191_01060) | - | 194283..194744 (+) | 462 | WP_010922462.1 | DUF4355 domain-containing protein | - |
| P8191_RS01065 (P8191_01065) | - | 194769..195680 (+) | 912 | WP_010922461.1 | phage major capsid protein | - |
| P8191_RS01070 (P8191_01070) | - | 195680..195880 (+) | 201 | WP_010922460.1 | hypothetical protein | - |
| P8191_RS01075 (P8191_01075) | - | 195890..196312 (+) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| P8191_RS01080 (P8191_01080) | - | 196272..196610 (+) | 339 | WP_011285617.1 | hypothetical protein | - |
| P8191_RS01085 (P8191_01085) | - | 196603..196839 (+) | 237 | WP_010922457.1 | hypothetical protein | - |
| P8191_RS01090 (P8191_01090) | - | 196840..197175 (+) | 336 | WP_000573598.1 | hypothetical protein | - |
| P8191_RS01095 (P8191_01095) | - | 197187..197780 (+) | 594 | WP_010922456.1 | tail protein | - |
| P8191_RS01100 (P8191_01100) | - | 197791..198054 (+) | 264 | WP_010922455.1 | hypothetical protein | - |
| P8191_RS01105 (P8191_01105) | - | 198069..198440 (+) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| P8191_RS01110 (P8191_01110) | - | 198440..200797 (+) | 2358 | WP_010922453.1 | hypothetical protein | - |
| P8191_RS01115 (P8191_01115) | - | 200794..201489 (+) | 696 | WP_010922452.1 | hypothetical protein | - |
| P8191_RS01120 (P8191_01120) | - | 201486..203444 (+) | 1959 | WP_010922451.1 | phage tail spike protein | - |
| P8191_RS01125 (P8191_01125) | - | 203444..204445 (+) | 1002 | WP_023079488.1 | hyaluronidase HylP | - |
| P8191_RS01130 (P8191_01130) | - | 204460..206244 (+) | 1785 | WP_010922449.1 | gp58-like family protein | - |
| P8191_RS01135 (P8191_01135) | - | 206256..206687 (+) | 432 | WP_010922448.1 | DUF1617 family protein | - |
| P8191_RS01140 (P8191_01140) | - | 206690..207307 (+) | 618 | WP_010922447.1 | DUF1366 domain-containing protein | - |
| P8191_RS01145 (P8191_01145) | - | 207317..207592 (+) | 276 | WP_002987582.1 | hypothetical protein | - |
| P8191_RS01150 (P8191_01150) | - | 207589..207816 (+) | 228 | WP_003058873.1 | phage holin | - |
| P8191_RS01155 (P8191_01155) | - | 207932..209137 (+) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| P8191_RS01160 (P8191_01160) | - | 209207..209641 (-) | 435 | WP_011017966.1 | hypothetical protein | - |
| P8191_RS01165 (P8191_01165) | sda3 | 209912..210712 (-) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| P8191_RS01170 (P8191_01170) | prx | 210941..211123 (+) | 183 | WP_029714291.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6974.02 Da Isoelectric Point: 4.7361
>NTDB_id=811314 P8191_RS01170 WP_029714291.1 210941..211123(+) (prx) [Streptococcus pyogenes strain 1044]
MLTYDEFKQAIDRGYITGDTVMIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDRGYITGDTVMIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=811314 P8191_RS01170 WP_029714291.1 210941..211123(+) (prx) [Streptococcus pyogenes strain 1044]
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
95 |
100 |
0.95 |
| prx | Streptococcus pyogenes MGAS315 |
90 |
100 |
0.9 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
71.667 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
68.333 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |