Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | P8R99_RS06195 | Genome accession | NZ_CP121160 |
| Coordinates | 1198878..1199060 (-) | Length | 60 a.a. |
| NCBI ID | WP_222335082.1 | Uniprot ID | - |
| Organism | Streptococcus agalactiae strain S5 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1196652..1238542 | 1198878..1199060 | within | 0 |
Gene organization within MGE regions
Location: 1196652..1238542
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8R99_RS06180 | - | 1196652..1197227 (-) | 576 | WP_001231504.1 | glucosaminidase domain-containing protein | - |
| P8R99_RS06185 | - | 1197224..1197976 (-) | 753 | WP_000739808.1 | M15 family metallopeptidase | - |
| P8R99_RS06190 | - | 1197973..1198665 (-) | 693 | WP_000049274.1 | histidine phosphatase family protein | - |
| P8R99_RS06195 | prx | 1198878..1199060 (-) | 183 | WP_222335082.1 | Paratox | Regulator |
| P8R99_RS06200 | - | 1199172..1199372 (-) | 201 | WP_000076712.1 | CsbD family protein | - |
| P8R99_RS06205 | - | 1199482..1199781 (-) | 300 | WP_000258211.1 | STAS-like domain-containing protein | - |
| P8R99_RS06210 | - | 1199775..1200671 (-) | 897 | WP_001061853.1 | sensor histidine kinase | - |
| P8R99_RS06215 | - | 1200807..1202137 (-) | 1331 | Protein_1200 | GH25 family lysozyme | - |
| P8R99_RS06220 | - | 1202267..1202518 (-) | 252 | WP_222334957.1 | phage holin | - |
| P8R99_RS06225 | - | 1202520..1202807 (-) | 288 | WP_025196063.1 | hypothetical protein | - |
| P8R99_RS06230 | - | 1202826..1202984 (-) | 159 | WP_223297809.1 | hypothetical protein | - |
| P8R99_RS06235 | - | 1203013..1203339 (-) | 327 | WP_222335085.1 | DUF1366 domain-containing protein | - |
| P8R99_RS06240 | - | 1203353..1205344 (-) | 1992 | WP_065733340.1 | DUF859 family phage minor structural protein | - |
| P8R99_RS06245 | - | 1205357..1209175 (-) | 3819 | WP_278043251.1 | glucosaminidase domain-containing protein | - |
| P8R99_RS06250 | - | 1209166..1210686 (-) | 1521 | WP_222335090.1 | distal tail protein Dit | - |
| P8R99_RS06255 | - | 1210697..1212895 (-) | 2199 | WP_053515049.1 | hypothetical protein | - |
| P8R99_RS06260 | - | 1212888..1213346 (-) | 459 | WP_053515048.1 | hypothetical protein | - |
| P8R99_RS06265 | - | 1213319..1213636 (-) | 318 | WP_053515047.1 | hypothetical protein | - |
| P8R99_RS06270 | - | 1213649..1214155 (-) | 507 | WP_053515046.1 | phage major tail protein, TP901-1 family | - |
| P8R99_RS06275 | - | 1214167..1214577 (-) | 411 | WP_278043252.1 | DUF5072 family protein | - |
| P8R99_RS06280 | - | 1214579..1214974 (-) | 396 | WP_053515044.1 | hypothetical protein | - |
| P8R99_RS06285 | - | 1214971..1215282 (-) | 312 | WP_053515043.1 | hypothetical protein | - |
| P8R99_RS06290 | - | 1215279..1215623 (-) | 345 | WP_053515042.1 | hypothetical protein | - |
| P8R99_RS06295 | - | 1215637..1215930 (-) | 294 | WP_222334961.1 | HeH/LEM domain-containing protein | - |
| P8R99_RS06300 | - | 1215943..1216833 (-) | 891 | WP_053515040.1 | hypothetical protein | - |
| P8R99_RS06305 | - | 1216852..1217421 (-) | 570 | WP_053515039.1 | DUF4355 domain-containing protein | - |
| P8R99_RS06310 | - | 1217535..1217861 (-) | 327 | WP_053515038.1 | hypothetical protein | - |
| P8R99_RS06315 | - | 1217995..1218921 (-) | 927 | WP_061811549.1 | minor capsid protein | - |
| P8R99_RS06320 | - | 1218890..1220215 (-) | 1326 | WP_065367292.1 | phage portal protein | - |
| P8R99_RS06325 | - | 1220215..1221489 (-) | 1275 | WP_000634503.1 | PBSX family phage terminase large subunit | - |
| P8R99_RS06330 | - | 1221479..1221859 (-) | 381 | WP_000090087.1 | hypothetical protein | - |
| P8R99_RS06340 | - | 1223195..1223632 (-) | 438 | WP_017648353.1 | DUF1492 domain-containing protein | - |
| P8R99_RS06345 | - | 1224092..1224310 (-) | 219 | WP_202618508.1 | hypothetical protein | - |
| P8R99_RS06350 | - | 1224328..1224645 (-) | 318 | WP_053515035.1 | hypothetical protein | - |
| P8R99_RS06355 | - | 1224632..1225162 (-) | 531 | WP_129316756.1 | DUF1642 domain-containing protein | - |
| P8R99_RS06360 | - | 1225364..1225558 (-) | 195 | WP_223875820.1 | hypothetical protein | - |
| P8R99_RS06365 | - | 1225619..1225831 (-) | 213 | WP_003047486.1 | hypothetical protein | - |
| P8R99_RS06370 | - | 1225828..1226232 (-) | 405 | WP_222335087.1 | YopX family protein | - |
| P8R99_RS06375 | - | 1226229..1226387 (-) | 159 | WP_017647865.1 | hypothetical protein | - |
| P8R99_RS06380 | - | 1226371..1226667 (-) | 297 | WP_222334966.1 | nucleotide modification associated domain-containing protein | - |
| P8R99_RS06385 | - | 1226664..1226912 (-) | 249 | WP_222334967.1 | hypothetical protein | - |
| P8R99_RS06390 | - | 1226909..1227265 (-) | 357 | WP_222334968.1 | hypothetical protein | - |
| P8R99_RS06395 | - | 1227249..1227536 (-) | 288 | WP_230243757.1 | VRR-NUC domain-containing protein | - |
| P8R99_RS06400 | - | 1227556..1228428 (-) | 873 | WP_222335088.1 | bifunctional DNA primase/polymerase | - |
| P8R99_RS06405 | - | 1228697..1230250 (-) | 1554 | WP_222335089.1 | phage resistance protein | - |
| P8R99_RS06410 | - | 1230267..1230749 (-) | 483 | WP_222334972.1 | DUF669 domain-containing protein | - |
| P8R99_RS06415 | - | 1230754..1232136 (-) | 1383 | WP_230249748.1 | DEAD/DEAH box helicase family protein | - |
| P8R99_RS06420 | - | 1232193..1232876 (-) | 684 | WP_000704951.1 | AAA family ATPase | - |
| P8R99_RS06425 | - | 1232863..1233153 (-) | 291 | WP_000650504.1 | hypothetical protein | - |
| P8R99_RS06430 | - | 1233150..1233350 (-) | 201 | WP_001058282.1 | hypothetical protein | - |
| P8R99_RS06435 | - | 1233426..1233569 (-) | 144 | WP_017647875.1 | hypothetical protein | - |
| P8R99_RS06440 | - | 1233599..1233856 (-) | 258 | WP_001191791.1 | hypothetical protein | - |
| P8R99_RS06445 | - | 1233934..1234119 (-) | 186 | WP_017285241.1 | helix-turn-helix transcriptional regulator | - |
| P8R99_RS06450 | - | 1234263..1234439 (+) | 177 | WP_164971201.1 | hypothetical protein | - |
| P8R99_RS06455 | - | 1234467..1234655 (-) | 189 | WP_000724352.1 | hypothetical protein | - |
| P8R99_RS06460 | - | 1234688..1235416 (-) | 729 | WP_017647877.1 | phage antirepressor KilAC domain-containing protein | - |
| P8R99_RS06465 | - | 1235464..1235664 (-) | 201 | WP_001875236.1 | helix-turn-helix transcriptional regulator | - |
| P8R99_RS06470 | - | 1235853..1236215 (+) | 363 | WP_061811548.1 | helix-turn-helix transcriptional regulator | - |
| P8R99_RS06475 | - | 1236199..1236576 (+) | 378 | WP_053515022.1 | ImmA/IrrE family metallo-endopeptidase | - |
| P8R99_RS06480 | - | 1236585..1237271 (+) | 687 | WP_053515021.1 | hypothetical protein | - |
| P8R99_RS06485 | - | 1237445..1238542 (+) | 1098 | WP_000570848.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6898.94 Da Isoelectric Point: 4.1370
>NTDB_id=810672 P8R99_RS06195 WP_222335082.1 1198878..1199060(-) (prx) [Streptococcus agalactiae strain S5]
MLYIDELQEAIDKGYISGNTVAIVRKNGKIFDYVLPGEPVRLWEVATEEKVEEVLMELDK
MLYIDELQEAIDKGYISGNTVAIVRKNGKIFDYVLPGEPVRLWEVATEEKVEEVLMELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=810672 P8R99_RS06195 WP_222335082.1 1198878..1199060(-) (prx) [Streptococcus agalactiae strain S5]
ATGTTATATATAGATGAGCTACAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCTGGTGAGCCTGTAAGATTGTGGGAAGTTGCGACAGAGGAAAAAGTGGAAGAAG
TGTTGATGGAATTAGATAAATAA
ATGTTATATATAGATGAGCTACAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCTGGTGAGCCTGTAAGATTGTGGGAAGTTGCGACAGAGGAAAAAGTGGAAGAAG
TGTTGATGGAATTAGATAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
70 |
100 |
0.7 |
| prx | Streptococcus pyogenes MGAS8232 |
66.667 |
100 |
0.667 |
| prx | Streptococcus pyogenes MGAS315 |
65 |
100 |
0.65 |
| prx | Streptococcus pyogenes MGAS315 |
61.667 |
100 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
68.333 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
75.61 |
68.333 |
0.517 |
| prx | Streptococcus pyogenes MGAS315 |
68.293 |
68.333 |
0.467 |