Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | P8R99_RS03475 | Genome accession | NZ_CP121160 |
| Coordinates | 698331..698519 (-) | Length | 62 a.a. |
| NCBI ID | WP_000027835.1 | Uniprot ID | A0AAV3JNT7 |
| Organism | Streptococcus agalactiae strain S5 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 698954..707709 | 698331..698519 | flank | 435 |
| IS/Tn | 698954..699565 | 698331..698519 | flank | 435 |
Gene organization within MGE regions
Location: 698331..707709
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8R99_RS03475 | prx | 698331..698519 (-) | 189 | WP_000027835.1 | hypothetical protein | Regulator |
| P8R99_RS03480 | - | 698561..698740 (-) | 180 | WP_000076709.1 | CsbD family protein | - |
| P8R99_RS03485 | - | 698918..699565 (+) | 648 | Protein_690 | IS3 family transposase | - |
| P8R99_RS03490 | - | 699617..700918 (-) | 1302 | WP_000734168.1 | HAMP domain-containing sensor histidine kinase | - |
| P8R99_RS03495 | - | 700915..701568 (-) | 654 | WP_000699093.1 | response regulator transcription factor | - |
| P8R99_RS03500 | - | 701665..703041 (-) | 1377 | WP_000594351.1 | FtsX-like permease family protein | - |
| P8R99_RS03505 | - | 703041..703697 (-) | 657 | WP_000353149.1 | ABC transporter ATP-binding protein | - |
| P8R99_RS03510 | - | 703707..704984 (-) | 1278 | WP_000594367.1 | ABC transporter permease | - |
| P8R99_RS03515 | - | 705726..705887 (+) | 162 | WP_000508795.1 | NINE protein | - |
| P8R99_RS03520 | - | 706060..707422 (-) | 1363 | Protein_697 | IS3 family transposase | - |
| P8R99_RS03525 | - | 707443..707709 (+) | 267 | WP_001872365.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7180.25 Da Isoelectric Point: 4.7815
>NTDB_id=810662 P8R99_RS03475 WP_000027835.1 698331..698519(-) (prx) [Streptococcus agalactiae strain S5]
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
Nucleotide
Download Length: 189 bp
>NTDB_id=810662 P8R99_RS03475 WP_000027835.1 698331..698519(-) (prx) [Streptococcus agalactiae strain S5]
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
72.222 |
87.097 |
0.629 |
| prx | Streptococcus pyogenes MGAS8232 |
69.091 |
88.71 |
0.613 |
| prx | Streptococcus pyogenes MGAS315 |
66.667 |
87.097 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
64.516 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
61.818 |
88.71 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
74.359 |
62.903 |
0.468 |
| prx | Streptococcus pyogenes MGAS315 |
78.378 |
59.677 |
0.468 |