Detailed information NTG0808810

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: RMP67_RS00905
• Genome accession: NZ_CP135087
• Coordinates: 157343..157750 (+)
• Length: 135 a.a.
• NCBI ID: WP_313920910.1
• Uniprot ID: -
• Organism: Streptococcus suis strain ID26102
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 152343..162750

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
RMP67_RS00875 (RMP67_00875)	-	152937..153305 (+)	369	WP_313920907.1	DUF1033 family protein	-
RMP67_RS00880 (RMP67_00880)	tnpA	153441..153915 (-)	475	Protein_139	IS200/IS605 family transposase	-
RMP67_RS00885 (RMP67_00885)	-	154144..155094 (-)	951	WP_313920908.1	LD-carboxypeptidase	-
RMP67_RS00890 (RMP67_00890)	comGA	155180..156130 (+)	951	WP_105140681.1	competence type IV pilus ATPase ComGA	Machinery gene
RMP67_RS00895 (RMP67_00895)	comGB	156042..157079 (+)	1038	WP_313921433.1	competence type IV pilus assembly protein ComGB	Machinery gene
RMP67_RS00900 (RMP67_00900)	comGC	157081..157362 (+)	282	WP_313920909.1	competence type IV pilus major pilin ComGC	Machinery gene
RMP67_RS00905 (RMP67_00905)	comGD	157343..157750 (+)	408	WP_313920910.1	competence type IV pilus minor pilin ComGD	Machinery gene
RMP67_RS00910 (RMP67_00910)	comGE	157722..158015 (+)	294	WP_024413203.1	competence type IV pilus minor pilin ComGE	Machinery gene
RMP67_RS00915 (RMP67_00915)	comGF/cglF	158002..158436 (+)	435	WP_024395445.1	competence type IV pilus minor pilin ComGF	Machinery gene
RMP67_RS00920 (RMP67_00920)	comGG	158414..158941 (+)	528	WP_313920911.1	competence type IV pilus minor pilin ComGG	-
RMP67_RS00925 (RMP67_00925)	comGH	158997..159950 (+)	954	WP_105105703.1	class I SAM-dependent methyltransferase	Machinery gene
RMP67_RS00930 (RMP67_00930)	-	160000..161187 (+)	1188	WP_313920912.1	acetate kinase	-
RMP67_RS00935 (RMP67_00935)	-	161263..162126 (-)	864	WP_313920913.1	IS982 family transposase	-
RMP67_RS00940 (RMP67_00940)	-	162471..162644 (+)	174	WP_313920914.1	hypothetical protein	-

Sequence

Protein

• Length: 135 a.a.
• Molecular weight: 15362.62 Da
• Isoelectric Point: 9.7340

>NTDB_id=808810 RMP67_RS00905 WP_313920910.1 157343..157750(+) (comGD) [Streptococcus suis strain ID26102]
MLRRKNKAFTLLESLLTLFVVSFLAVSLSGTVQTVFQSVQEEIFLWEFEAIYKDSQKLAASSHQSVSLTIGKQEVTNGHQ
VVQVPRNVEVLEGKTITFEEDGGNSSLTKIRFRLRQKIVTYQLYIGSGRYKKTEE

Nucleotide

• Length: 408 bp

>NTDB_id=808810 RMP67_RS00905 WP_313920910.1 157343..157750(+) (comGD) [Streptococcus suis strain ID26102]
ATGCTAAGGCGAAAAAATAAGGCTTTCACGCTTTTGGAAAGTCTGCTGACCTTATTTGTTGTCAGTTTTTTAGCTGTTTC
CTTATCGGGAACAGTGCAGACAGTCTTTCAGTCTGTTCAGGAAGAAATTTTTCTCTGGGAATTTGAGGCCATCTATAAAG
ACAGTCAGAAATTGGCAGCTAGTTCTCACCAGTCAGTTAGCTTGACTATCGGCAAACAAGAAGTGACAAATGGTCATCAG
GTAGTCCAGGTACCCAGAAATGTAGAAGTATTAGAAGGGAAGACCATCACATTTGAAGAAGATGGTGGAAATTCTTCTCT
GACCAAGATTCGTTTTCGGCTTAGGCAAAAAATAGTCACGTATCAATTATATATAGGGAGTGGTCGCTATAAGAAAACAG
AAGAATAA

Domains

Predicted by InterProScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (3-28)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Streptococcus mutans UA140	47.287	95.556	0.452
comGD	Streptococcus mutans UA159	47.287	95.556	0.452
comGD/cglD	Streptococcus pneumoniae TIGR4	46.512	95.556	0.444
comGD/cglD	Streptococcus pneumoniae R6	46.512	95.556	0.444
comGD/cglD	Streptococcus pneumoniae D39	46.512	95.556	0.444
comGD/cglD	Streptococcus pneumoniae Rx1	46.512	95.556	0.444
comGD	Streptococcus gordonii str. Challis substr. CH1	47.244	94.074	0.444
comGD/cglD	Streptococcus mitis SK321	45.736	95.556	0.437
comGD/cglD	Streptococcus mitis NCTC 12261	45.736	95.556	0.437
comGD	Lactococcus lactis subsp. cremoris KW2	40.769	96.296	0.393