Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | P3L36_RS01060 | Genome accession | NZ_CP120654 |
| Coordinates | 146421..146603 (+) | Length | 60 a.a. |
| NCBI ID | WP_000965649.1 | Uniprot ID | A0AAV3JNR0 |
| Organism | Streptococcus agalactiae strain Guangzhou-SAG036 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 102482..148829 | 146421..146603 | within | 0 |
Gene organization within MGE regions
Location: 102482..148829
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P3L36_RS00715 (P3L36_00715) | - | 102482..103579 (-) | 1098 | WP_000570847.1 | site-specific integrase | - |
| P3L36_RS00720 (P3L36_00720) | - | 103752..104366 (-) | 615 | WP_000742866.1 | hypothetical protein | - |
| P3L36_RS00725 (P3L36_00725) | - | 104498..105277 (-) | 780 | WP_000095652.1 | S24 family peptidase | - |
| P3L36_RS00730 (P3L36_00730) | - | 105638..105931 (+) | 294 | WP_270990850.1 | ImmA/IrrE family metallo-endopeptidase | - |
| P3L36_RS00735 (P3L36_00735) | - | 105915..106085 (-) | 171 | WP_001097075.1 | hypothetical protein | - |
| P3L36_RS00740 (P3L36_00740) | - | 106143..106301 (+) | 159 | WP_001104157.1 | hypothetical protein | - |
| P3L36_RS00745 (P3L36_00745) | - | 106332..106574 (+) | 243 | WP_000219235.1 | hypothetical protein | - |
| P3L36_RS00750 (P3L36_00750) | - | 106560..107117 (-) | 558 | WP_000880594.1 | hypothetical protein | - |
| P3L36_RS00755 (P3L36_00755) | - | 107173..107382 (+) | 210 | WP_001247539.1 | hypothetical protein | - |
| P3L36_RS00760 (P3L36_00760) | - | 107614..107820 (+) | 207 | WP_000164462.1 | helix-turn-helix transcriptional regulator | - |
| P3L36_RS00765 (P3L36_00765) | - | 107874..108833 (+) | 960 | WP_001156316.1 | hypothetical protein | - |
| P3L36_RS00770 (P3L36_00770) | - | 108826..109335 (+) | 510 | WP_000032141.1 | ORF6C domain-containing protein | - |
| P3L36_RS00775 (P3L36_00775) | - | 109368..109505 (+) | 138 | WP_000627309.1 | hypothetical protein | - |
| P3L36_RS00780 (P3L36_00780) | - | 109632..109778 (+) | 147 | WP_001867241.1 | hypothetical protein | - |
| P3L36_RS00785 (P3L36_00785) | - | 109741..110049 (-) | 309 | WP_001000651.1 | hypothetical protein | - |
| P3L36_RS00790 (P3L36_00790) | - | 110159..110416 (+) | 258 | WP_016480517.1 | hypothetical protein | - |
| P3L36_RS00795 (P3L36_00795) | - | 110445..110669 (+) | 225 | WP_047208982.1 | hypothetical protein | - |
| P3L36_RS00800 (P3L36_00800) | - | 110745..111458 (+) | 714 | WP_025196274.1 | DnaD domain protein | - |
| P3L36_RS00805 (P3L36_00805) | - | 111445..112227 (+) | 783 | WP_000600243.1 | ATP-binding protein | - |
| P3L36_RS00810 (P3L36_00810) | - | 112354..112629 (+) | 276 | WP_000431575.1 | hypothetical protein | - |
| P3L36_RS00815 (P3L36_00815) | - | 112616..112870 (+) | 255 | WP_047200442.1 | hypothetical protein | - |
| P3L36_RS00820 (P3L36_00820) | - | 112872..113033 (+) | 162 | WP_079398808.1 | hypothetical protein | - |
| P3L36_RS00825 (P3L36_00825) | - | 113035..113364 (+) | 330 | WP_047200443.1 | hypothetical protein | - |
| P3L36_RS00830 (P3L36_00830) | - | 113367..114347 (+) | 981 | WP_047200444.1 | RecT family recombinase | - |
| P3L36_RS00835 (P3L36_00835) | - | 114344..115141 (+) | 798 | WP_047200445.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| P3L36_RS00840 (P3L36_00840) | - | 115302..115499 (+) | 198 | WP_000474006.1 | hypothetical protein | - |
| P3L36_RS00845 (P3L36_00845) | - | 115489..115965 (+) | 477 | WP_000143298.1 | RusA family crossover junction endodeoxyribonuclease | - |
| P3L36_RS00850 (P3L36_00850) | - | 115955..116302 (+) | 348 | WP_047200446.1 | hypothetical protein | - |
| P3L36_RS00855 (P3L36_00855) | - | 116314..116601 (+) | 288 | WP_071661630.1 | nucleotide modification associated domain-containing protein | - |
| P3L36_RS00860 (P3L36_00860) | - | 116750..117190 (+) | 441 | WP_000612732.1 | YopX family protein | - |
| P3L36_RS00865 (P3L36_00865) | - | 117314..117457 (+) | 144 | WP_000564605.1 | hypothetical protein | - |
| P3L36_RS00870 (P3L36_00870) | - | 117454..117966 (+) | 513 | WP_001019149.1 | DUF1642 domain-containing protein | - |
| P3L36_RS00875 (P3L36_00875) | - | 117987..118286 (+) | 300 | WP_001105090.1 | hypothetical protein | - |
| P3L36_RS00880 (P3L36_00880) | - | 118474..118668 (+) | 195 | WP_000221696.1 | hypothetical protein | - |
| P3L36_RS00885 (P3L36_00885) | - | 118665..118931 (+) | 267 | WP_000660741.1 | hypothetical protein | - |
| P3L36_RS00890 (P3L36_00890) | - | 119322..119756 (+) | 435 | WP_000142570.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| P3L36_RS00900 (P3L36_00900) | - | 120312..120440 (+) | 129 | WP_017647279.1 | hypothetical protein | - |
| P3L36_RS00905 (P3L36_00905) | - | 120494..120871 (-) | 378 | WP_000964195.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| P3L36_RS00910 (P3L36_00910) | - | 120924..121109 (-) | 186 | WP_001132272.1 | type II toxin-antitoxin system HicA family toxin | - |
| P3L36_RS00915 (P3L36_00915) | - | 121210..121548 (+) | 339 | WP_001247768.1 | HNH endonuclease signature motif containing protein | - |
| P3L36_RS00920 (P3L36_00920) | - | 121720..122187 (+) | 468 | WP_000532791.1 | phage terminase small subunit P27 family | - |
| P3L36_RS00925 (P3L36_00925) | - | 122202..123956 (+) | 1755 | WP_000151569.1 | terminase TerL endonuclease subunit | - |
| P3L36_RS00930 (P3L36_00930) | - | 123953..124120 (+) | 168 | WP_000578945.1 | hypothetical protein | - |
| P3L36_RS00935 (P3L36_00935) | - | 124117..124347 (+) | 231 | WP_001042284.1 | hypothetical protein | - |
| P3L36_RS00940 (P3L36_00940) | - | 124354..125574 (+) | 1221 | WP_000007732.1 | phage portal protein | - |
| P3L36_RS00945 (P3L36_00945) | - | 125552..126217 (+) | 666 | WP_071661629.1 | head maturation protease, ClpP-related | - |
| P3L36_RS00950 (P3L36_00950) | - | 126241..127425 (+) | 1185 | WP_000459130.1 | phage major capsid protein | - |
| P3L36_RS00955 (P3L36_00955) | - | 127439..127600 (+) | 162 | WP_017285214.1 | hypothetical protein | - |
| P3L36_RS00960 (P3L36_00960) | - | 127603..127905 (+) | 303 | WP_000218659.1 | head-tail connector protein | - |
| P3L36_RS00965 (P3L36_00965) | - | 127902..128249 (+) | 348 | WP_000632972.1 | phage head closure protein | - |
| P3L36_RS00970 (P3L36_00970) | - | 128246..128623 (+) | 378 | WP_000160228.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| P3L36_RS00975 (P3L36_00975) | - | 128620..129045 (+) | 426 | WP_000559944.1 | hypothetical protein | - |
| P3L36_RS00980 (P3L36_00980) | - | 129061..129684 (+) | 624 | WP_000521118.1 | major tail protein | - |
| P3L36_RS00985 (P3L36_00985) | - | 129738..130058 (+) | 321 | WP_000273027.1 | hypothetical protein | - |
| P3L36_RS00990 (P3L36_00990) | - | 130088..130255 (+) | 168 | WP_000264971.1 | hypothetical protein | - |
| P3L36_RS00995 (P3L36_00995) | - | 130268..134209 (+) | 3942 | WP_050977834.1 | phage tail tape measure protein | - |
| P3L36_RS01000 (P3L36_01000) | - | 134206..135729 (+) | 1524 | WP_050977835.1 | distal tail protein Dit | - |
| P3L36_RS01005 (P3L36_01005) | - | 135720..139547 (+) | 3828 | WP_050977836.1 | phage tail protein | - |
| P3L36_RS01010 (P3L36_01010) | - | 139558..141570 (+) | 2013 | WP_050977837.1 | DUF859 family phage minor structural protein | - |
| P3L36_RS01015 (P3L36_01015) | - | 141584..141910 (+) | 327 | WP_000404431.1 | DUF1366 domain-containing protein | - |
| P3L36_RS01020 (P3L36_01020) | - | 141885..142097 (+) | 213 | WP_000698337.1 | hypothetical protein | - |
| P3L36_RS01025 (P3L36_01025) | - | 142110..142412 (+) | 303 | WP_000215499.1 | hypothetical protein | - |
| P3L36_RS01030 (P3L36_01030) | - | 142414..142668 (+) | 255 | WP_000611524.1 | phage holin | - |
| P3L36_RS01035 (P3L36_01035) | - | 142794..144128 (+) | 1335 | WP_000257234.1 | GH25 family lysozyme | - |
| P3L36_RS01040 (P3L36_01040) | - | 144293..145189 (+) | 897 | WP_001061853.1 | sensor histidine kinase | - |
| P3L36_RS01045 (P3L36_01045) | - | 145183..145482 (+) | 300 | WP_000258211.1 | STAS-like domain-containing protein | - |
| P3L36_RS01050 (P3L36_01050) | - | 145592..145792 (+) | 201 | WP_000076712.1 | CsbD family protein | - |
| P3L36_RS01055 (P3L36_01055) | - | 145833..146003 (-) | 171 | WP_000356856.1 | hypothetical protein | - |
| P3L36_RS01060 (P3L36_01060) | prx | 146421..146603 (+) | 183 | WP_000965649.1 | hypothetical protein | Regulator |
| P3L36_RS01065 (P3L36_01065) | - | 146816..147508 (+) | 693 | WP_000049277.1 | histidine phosphatase family protein | - |
| P3L36_RS01070 (P3L36_01070) | - | 147505..148257 (+) | 753 | WP_000739666.1 | M15 family metallopeptidase | - |
| P3L36_RS01075 (P3L36_01075) | - | 148254..148829 (+) | 576 | WP_001231504.1 | glucosaminidase domain-containing protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7024.13 Da Isoelectric Point: 4.1954
>NTDB_id=807503 P3L36_RS01060 WP_000965649.1 146421..146603(+) (prx) [Streptococcus agalactiae strain Guangzhou-SAG036]
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPGEPVRLWEVATEEKVEEVLMELDK
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPGEPVRLWEVATEEKVEEVLMELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=807503 P3L36_RS01060 WP_000965649.1 146421..146603(+) (prx) [Streptococcus agalactiae strain Guangzhou-SAG036]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAGAA
CGGAAAGATATTTGATTATGTGTTACCTGGTGAGCCTGTAAGATTGTGGGAAGTTGCGACAGAGGAAAAAGTGGAAGAAG
TGTTGATGGAATTAGATAAATAA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAGAA
CGGAAAGATATTTGATTATGTGTTACCTGGTGAGCCTGTAAGATTGTGGGAAGTTGCGACAGAGGAAAAAGTGGAAGAAG
TGTTGATGGAATTAGATAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
68.333 |
100 |
0.683 |
| prx | Streptococcus pyogenes MGAS315 |
65 |
100 |
0.65 |
| prx | Streptococcus pyogenes MGAS315 |
65 |
100 |
0.65 |
| prx | Streptococcus pyogenes MGAS8232 |
65 |
100 |
0.65 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
68.333 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
73.171 |
68.333 |
0.5 |
| prx | Streptococcus pyogenes MGAS315 |
70.732 |
68.333 |
0.483 |