NTDB

Overview

Name	clpP	Type	Regulator
Locus tag	P5657_RS05920	Genome accession	NZ_CP120621
Coordinates	1137505..1138098 (+)	Length	197 a.a.
NCBI ID	WP_003228214.1	Uniprot ID	A0A199WEF2
Organism	Bacillus subtilis strain DSM 13019
Function	degradation of ComK; degradation of DegU (predicted from homology) Competence regulation

Genomic Context

Location: 1132505..1143098

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
P5657_RS05890 (P5657_05890)	aspP	1133477..1135039 (+)	1563	WP_003228228.1	aspartate/proton symporter AspP	-
P5657_RS05895 (P5657_05895)	-	1135134..1135718 (+)	585	WP_175405003.1	TetR family transcriptional regulator	-
P5657_RS05900 (P5657_05900)	psmA	1135800..1136135 (+)	336	WP_003242480.1	SMR family transporter	-
P5657_RS05905 (P5657_05905)	psmB	1136135..1136455 (+)	321	WP_003228222.1	QacE family quaternary ammonium compound efflux SMR transporter	-
P5657_RS05910 (P5657_05910)	yvdQ	1136491..1137003 (-)	513	WP_014478056.1	DUF3231 family protein	-
P5657_RS05920 (P5657_05920)	clpP	1137505..1138098 (+)	594	WP_003228214.1	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	Regulator
P5657_RS05925 (P5657_05925)	pgmB	1138143..1138817 (-)	675	WP_072175093.1	beta-phosphoglucomutase	-
P5657_RS05930 (P5657_05930)	malL	1138814..1140499 (-)	1686	WP_070547814.1	oligo-1,6-glucosidase	-
P5657_RS05935 (P5657_05935)	mdxK	1140492..1142765 (-)	2274	WP_134991856.1	maltose phosphorylase	-

Sequence

Protein

Download Length: 197 a.a. Molecular weight: 21682.00 Da Isoelectric Point: 4.9416

                                >NTDB_id=807031 P5657_RS05920 WP_003228214.1 1137505..1138098(+) (clpP) [Bacillus subtilis strain DSM 13019]

MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLAAEDPEKEISLYINSPGGSITAGMAIYDT

MQFIKPKVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILLLRDKLNKVLAERTGQ

PLEVIERDTDRDNFKSAEEALEYGLIDKILTHTEDKK

Nucleotide

Download Length: 594 bp

                                >NTDB_id=807031 P5657_RS05920 WP_003228214.1 1137505..1138098(+) (clpP) [Bacillus subtilis strain DSM 13019]

ATGAATTTAATACCTACAGTCATTGAACAAACGAACCGCGGAGAAAGAGCGTATGACATTTATTCTCGTCTATTAAAGGA

TCGTATCATCATGCTTGGATCTGCGATTGATGACAACGTTGCGAACTCCATCGTGTCACAGCTTTTATTCTTAGCAGCAG

AAGACCCTGAAAAAGAAATTTCTCTTTACATCAACAGCCCGGGCGGCTCTATTACAGCCGGTATGGCGATCTATGATACC

ATGCAGTTTATTAAGCCGAAGGTATCTACAATTTGTATCGGTATGGCTGCGTCAATGGGCGCGTTCCTGCTTGCAGCCGG

CGAAAAAGGCAAACGCTATGCGCTTCCAAACAGTGAAGTCATGATTCACCAGCCTCTTGGCGGTGCGCAAGGTCAAGCGA

CAGAAATTGAAATTGCTGCGAAACGCATTCTCTTGCTTCGCGACAAATTAAACAAAGTCCTAGCTGAACGTACTGGCCAG

CCGCTTGAAGTGATCGAACGTGACACAGACCGTGATAACTTCAAGTCTGCTGAAGAAGCGCTTGAATACGGCCTGATTGA

CAAAATTTTGACTCACACAGAAGACAAAAAGTAA

Domains

Predicted by InterproScan.

Clp protease (CLP_protease)

(13-192)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A199WEF2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
clpP	Bacillus subtilis subsp. subtilis str. 168	100	100	1
clpP	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	68.617	95.431	0.655
clpP	Streptococcus thermophilus LMG 18311	58.163	99.492	0.579
clpP	Streptococcus thermophilus LMD-9	58.163	99.492	0.579
clpP	Streptococcus pneumoniae D39	57.812	97.462	0.563
clpP	Streptococcus pneumoniae Rx1	57.812	97.462	0.563
clpP	Streptococcus pneumoniae R6	57.812	97.462	0.563
clpP	Streptococcus pneumoniae TIGR4	57.812	97.462	0.563
clpP	Lactococcus lactis subsp. cremoris KW2	57.895	96.447	0.558
clpP	Streptococcus pyogenes JRS4	56.122	99.492	0.558
clpP	Streptococcus pyogenes MGAS315	56.122	99.492	0.558
clpP	Streptococcus mutans UA159	54.822	100	0.548
clpP	Lactococcus lactis subsp. lactis strain DGCC12653	55.789	96.447	0.538

Detailed information NTG0807031