Detailed information NTG0805843

Bioinformatically predicted

Overview

• Name: clpP
• Type: Regulator
• Locus tag: P3R60_RS03320
• Genome accession: NZ_CP120510
• Coordinates: 669326..669916 (-)
• Length: 196 a.a.
• NCBI ID: WP_104967377.1
• Uniprot ID: -
• Organism: Streptococcus pluranimalium strain SP21-2
• Function: degradation of ComX; degradation of ComW (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Prophage	660838..669916	669326..669916	within	0
IS/Tn	667572..668915	669326..669916	flank	411

Gene organization within MGE regions

Location: 660838..669916

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
P3R60_RS03275	tmk	660838..661485 (-)	648	WP_218654094.1	dTMP kinase	-
P3R60_RS03280	-	661551..662210 (-)	660	WP_218654093.1	CBS and ACT domain-containing protein	-
P3R60_RS03285	-	662636..663346 (-)	711	WP_218654092.1	ABC transporter ATP-binding protein	-
P3R60_RS03290	-	663346..664110 (-)	765	WP_278025034.1	ABC transporter ATP-binding protein	-
P3R60_RS03295	-	664110..665063 (-)	954	WP_316606637.1	branched-chain amino acid ABC transporter permease	-
P3R60_RS03300	-	665068..665937 (-)	870	WP_104967380.1	branched-chain amino acid ABC transporter permease	-
P3R60_RS03305	-	666073..667248 (-)	1176	WP_316606638.1	ABC transporter substrate-binding protein	-
P3R60_RS03310	-	667572..668915 (+)	1344	WP_316606133.1	IS3 family transposase	-
P3R60_RS03315	-	668965..669222 (-)	258	WP_218654088.1	DUF2129 domain-containing protein	-
P3R60_RS03320	clpP	669326..669916 (-)	591	WP_104967377.1	ATP-dependent Clp protease proteolytic subunit	Regulator

Sequence

Protein

• Length: 196 a.a.
• Molecular weight: 21635.83 Da
• Isoelectric Point: 4.6424

>NTDB_id=805843 P3R60_RS03320 WP_104967377.1 669326..669916(-) (clpP) [Streptococcus pluranimalium strain SP21-2]
MIPVVIEQTSRGERSYDIYSRLLKDRIIMLTGPVEDNMANSVIAQLLFLDAQDPTKDIYLYVNTPGGSVSAGLAIVDTMN
FIKADVQTIVMGMAASMGTIIASSGAKGKRFMLPNAEYMMHQPMGGTGGGTQQTDMAIAAEHLLKTRHKLEKILSDNSGQ
TMEKIHIDAERDRWMDAEETLEYGFIDAIMDNNELK

Nucleotide

• Length: 591 bp

>NTDB_id=805843 P3R60_RS03320 WP_104967377.1 669326..669916(-) (clpP) [Streptococcus pluranimalium strain SP21-2]
ATGATTCCAGTAGTTATTGAACAAACATCACGTGGCGAACGCTCTTACGATATTTATTCACGTCTCTTAAAAGACCGTAT
TATCATGTTGACTGGTCCAGTTGAAGACAACATGGCTAACTCAGTGATTGCCCAGTTGCTCTTCTTGGATGCACAGGATC
CAACCAAAGATATTTACCTTTACGTTAACACACCAGGGGGTTCGGTTTCAGCTGGCTTAGCAATTGTTGATACCATGAAC
TTCATAAAAGCTGATGTCCAAACTATTGTTATGGGAATGGCAGCTTCAATGGGAACTATTATCGCTTCATCAGGTGCTAA
AGGTAAACGTTTTATGTTACCAAATGCAGAATACATGATGCACCAACCAATGGGCGGTACTGGTGGAGGTACCCAACAAA
CGGATATGGCTATTGCGGCTGAACACCTTTTGAAAACACGTCACAAATTAGAAAAAATTCTTTCTGATAACTCAGGACAA
ACTATGGAGAAAATCCATATTGATGCTGAACGTGATCGTTGGATGGATGCTGAGGAAACCCTTGAGTATGGTTTCATTGA
CGCTATCATGGATAATAATGAGTTGAAATAA

Domains

Predicted by InterproScan.

• Clp protease (CLP_protease) (11-192)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
clpP	Streptococcus pneumoniae Rx1	91.795	99.49	0.913
clpP	Streptococcus pneumoniae D39	91.795	99.49	0.913
clpP	Streptococcus pneumoniae R6	91.795	99.49	0.913
clpP	Streptococcus pneumoniae TIGR4	91.795	99.49	0.913
clpP	Streptococcus pyogenes MGAS315	90.816	100	0.908
clpP	Streptococcus pyogenes JRS4	90.816	100	0.908
clpP	Streptococcus thermophilus LMG 18311	89.796	100	0.898
clpP	Streptococcus thermophilus LMD-9	89.796	100	0.898
clpP	Streptococcus mutans UA159	89.286	100	0.893
clpP	Lactococcus lactis subsp. lactis strain DGCC12653	84.694	100	0.847
clpP	Lactococcus lactis subsp. cremoris KW2	84.184	100	0.842
clpP	Bacillus subtilis subsp. subtilis str. 168	58.163	100	0.582
clpP	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	56.995	98.469	0.561