Detailed information NTG0802974

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: P3U34_RS07130
• Genome accession: NZ_CP120106
• Coordinates: 1392964..1393281 (+)
• Length: 105 a.a.
• NCBI ID: WP_058611611.1
• Uniprot ID: -
• Organism: Mammaliicoccus sciuri strain Dog108
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1387964..1398281

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
P3U34_RS07090 (P3U34_07090)	-	1388109..1388300 (+)	192	WP_078099923.1	YqgQ family protein	-
P3U34_RS07095 (P3U34_07095)	-	1388297..1389268 (+)	972	WP_025904167.1	ROK family glucokinase	-
P3U34_RS07100 (P3U34_07100)	-	1389268..1389582 (+)	315	WP_058611614.1	MTH1187 family thiamine-binding protein	-
P3U34_RS07105 (P3U34_07105)	-	1389612..1389851 (-)	240	WP_016911885.1	DUF2759 domain-containing protein	-
P3U34_RS07110 (P3U34_07110)	-	1389949..1390581 (+)	633	WP_058611613.1	MBL fold metallo-hydrolase	-
P3U34_RS07115 (P3U34_07115)	-	1390615..1390863 (-)	249	WP_025904960.1	DUF2626 family protein	-
P3U34_RS07120 (P3U34_07120)	comGA	1391017..1391919 (+)	903	WP_058611612.1	competence type IV pilus ATPase ComGA	Machinery gene
P3U34_RS07125 (P3U34_07125)	comGB	1391909..1392949 (+)	1041	WP_077152202.1	competence type IV pilus assembly protein ComGB	-
P3U34_RS07130 (P3U34_07130)	comGC	1392964..1393281 (+)	318	WP_058611611.1	competence type IV pilus major pilin ComGC	Machinery gene
P3U34_RS07135 (P3U34_07135)	-	1393310..1393708 (+)	399	WP_049319406.1	hypothetical protein	-
P3U34_RS07140 (P3U34_07140)	comGE	1393692..1393973 (+)	282	WP_204253459.1	competence type IV pilus minor pilin ComGE	-
P3U34_RS07145 (P3U34_07145)	-	1393948..1394382 (+)	435	WP_049318781.1	competence type IV pilus minor pilin ComGF	-
P3U34_RS07150 (P3U34_07150)	-	1394617..1395105 (+)	489	WP_058611609.1	shikimate kinase	-
P3U34_RS07155 (P3U34_07155)	gcvT	1395298..1396386 (+)	1089	WP_204253536.1	glycine cleavage system aminomethyltransferase GcvT	-
P3U34_RS07160 (P3U34_07160)	gcvPA	1396398..1397741 (+)	1344	WP_058611607.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11605.67 Da
• Isoelectric Point: 8.5043

>NTDB_id=802974 P3U34_RS07130 WP_058611611.1 1392964..1393281(+) (comGC) [Mammaliicoccus sciuri strain Dog108]
MKRFKFLSKKEGFTLVEMLIVLLIISILLVIIIPNISKQSETVKSTGCQAQVKMVAGQVEAYTLKHDAKPNSINDLISDG
YINQKQLTCKSGETITLENGEVVAH

Nucleotide

• Length: 318 bp

>NTDB_id=802974 P3U34_RS07130 WP_058611611.1 1392964..1393281(+) (comGC) [Mammaliicoccus sciuri strain Dog108]
ATGAAAAGATTTAAATTTTTAAGTAAAAAAGAAGGGTTTACATTGGTTGAAATGTTAATTGTCCTTTTAATCATAAGTAT
ATTATTGGTGATCATCATACCAAACATCAGCAAGCAATCAGAGACGGTAAAAAGTACTGGATGCCAAGCACAAGTGAAAA
TGGTAGCTGGTCAAGTAGAAGCTTATACATTGAAACACGATGCTAAACCAAATTCTATAAATGATTTAATAAGTGATGGC
TATATTAACCAAAAGCAACTGACTTGTAAATCAGGAGAAACAATTACGCTAGAAAACGGTGAAGTTGTTGCACATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-32)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	65.686	97.143	0.638
comGC	Staphylococcus aureus MW2	65.686	97.143	0.638
comGC	Bacillus subtilis subsp. subtilis str. 168	47.312	88.571	0.419
comYC	Streptococcus mutans UA159	48.276	82.857	0.4
comYC	Streptococcus mutans UA140	48.276	82.857	0.4
comYC	Streptococcus gordonii str. Challis substr. CH1	47.674	81.905	0.39
comGC/cglC	Streptococcus mitis NCTC 12261	46.988	79.048	0.371
comGC/cglC	Streptococcus mitis SK321	46.988	79.048	0.371
comGC	Lactococcus lactis subsp. cremoris KW2	46.914	77.143	0.362
comYC	Streptococcus suis isolate S10	48.718	74.286	0.362