Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | PZB81_RS08975 | Genome accession | NZ_CP119047 |
| Coordinates | 1881636..1882106 (-) | Length | 156 a.a. |
| NCBI ID | WP_002493401.1 | Uniprot ID | - |
| Organism | Staphylococcus epidermidis strain N2 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1845104..1890886 | 1881636..1882106 | within | 0 |
Gene organization within MGE regions
Location: 1845104..1890886
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PZB81_RS08720 (PZB81_08720) | - | 1845104..1845541 (-) | 438 | WP_002493351.1 | hypothetical protein | - |
| PZB81_RS08725 (PZB81_08725) | - | 1846021..1847229 (-) | 1209 | WP_002493352.1 | Fic family protein | - |
| PZB81_RS08730 (PZB81_08730) | - | 1847641..1849044 (-) | 1404 | WP_002493353.1 | N-acetylmuramoyl-L-alanine amidase | - |
| PZB81_RS08735 (PZB81_08735) | - | 1849044..1849313 (-) | 270 | WP_002493354.1 | phage holin | - |
| PZB81_RS08740 (PZB81_08740) | - | 1849369..1849899 (-) | 531 | WP_002493355.1 | hypothetical protein | - |
| PZB81_RS08745 (PZB81_08745) | - | 1849899..1850408 (-) | 510 | WP_002493356.1 | hypothetical protein | - |
| PZB81_RS08750 (PZB81_08750) | - | 1850461..1850670 (-) | 210 | Protein_1690 | CHAP domain-containing protein | - |
| PZB81_RS08755 (PZB81_08755) | - | 1850674..1850922 (-) | 249 | Protein_1691 | phage holin | - |
| PZB81_RS08760 (PZB81_08760) | - | 1850986..1851384 (-) | 399 | WP_002493358.1 | YxeA family protein | - |
| PZB81_RS08765 (PZB81_08765) | - | 1851512..1851658 (-) | 147 | WP_002493359.1 | XkdX family protein | - |
| PZB81_RS08770 (PZB81_08770) | - | 1851651..1851986 (-) | 336 | WP_002493360.1 | hypothetical protein | - |
| PZB81_RS08775 (PZB81_08775) | - | 1851998..1853656 (-) | 1659 | WP_002493361.1 | BppU family phage baseplate upper protein | - |
| PZB81_RS08780 (PZB81_08780) | - | 1853709..1855625 (-) | 1917 | WP_275113478.1 | glucosaminidase domain-containing protein | - |
| PZB81_RS08785 (PZB81_08785) | - | 1855680..1856078 (-) | 399 | WP_002493363.1 | hypothetical protein | - |
| PZB81_RS08790 (PZB81_08790) | - | 1856059..1856481 (-) | 423 | WP_002493364.1 | hypothetical protein | - |
| PZB81_RS08795 (PZB81_08795) | - | 1856495..1857682 (-) | 1188 | WP_002493365.1 | BppU family phage baseplate upper protein | - |
| PZB81_RS08800 (PZB81_08800) | - | 1857698..1859581 (-) | 1884 | WP_002493366.1 | M14 family metallopeptidase | - |
| PZB81_RS08805 (PZB81_08805) | - | 1859584..1861044 (-) | 1461 | WP_002493367.1 | phage tail protein | - |
| PZB81_RS08810 (PZB81_08810) | - | 1861056..1862012 (-) | 957 | WP_002493368.1 | phage tail domain-containing protein | - |
| PZB81_RS08815 (PZB81_08815) | - | 1862024..1865743 (-) | 3720 | WP_002493369.1 | hypothetical protein | - |
| PZB81_RS08820 (PZB81_08820) | - | 1865758..1866102 (-) | 345 | WP_033862682.1 | hypothetical protein | - |
| PZB81_RS08825 (PZB81_08825) | - | 1866144..1866503 (-) | 360 | WP_002493371.1 | tail assembly chaperone | - |
| PZB81_RS08830 (PZB81_08830) | - | 1866568..1867122 (-) | 555 | WP_002493372.1 | phage major tail protein, TP901-1 family | - |
| PZB81_RS08835 (PZB81_08835) | - | 1867165..1867554 (-) | 390 | WP_002493373.1 | hypothetical protein | - |
| PZB81_RS08840 (PZB81_08840) | - | 1867554..1867916 (-) | 363 | WP_002493374.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| PZB81_RS08845 (PZB81_08845) | - | 1867916..1868218 (-) | 303 | WP_002493375.1 | hypothetical protein | - |
| PZB81_RS08850 (PZB81_08850) | - | 1868215..1868544 (-) | 330 | WP_002493376.1 | phage head-tail connector protein | - |
| PZB81_RS08855 (PZB81_08855) | - | 1868546..1868815 (-) | 270 | WP_002493377.1 | hypothetical protein | - |
| PZB81_RS08860 (PZB81_08860) | - | 1868837..1869763 (-) | 927 | WP_002493378.1 | phage major capsid protein | - |
| PZB81_RS08865 (PZB81_08865) | - | 1869780..1870385 (-) | 606 | WP_002493379.1 | DUF4355 domain-containing protein | - |
| PZB81_RS08870 (PZB81_08870) | - | 1870639..1870782 (-) | 144 | WP_002493380.1 | hypothetical protein | - |
| PZB81_RS08875 (PZB81_08875) | - | 1870775..1871323 (-) | 549 | WP_002493381.1 | hypothetical protein | - |
| PZB81_RS08880 (PZB81_08880) | - | 1871337..1872275 (-) | 939 | WP_002493382.1 | minor capsid protein | - |
| PZB81_RS08885 (PZB81_08885) | - | 1872282..1873811 (-) | 1530 | WP_002493383.1 | phage portal protein | - |
| PZB81_RS08890 (PZB81_08890) | - | 1873823..1875121 (-) | 1299 | WP_002493384.1 | PBSX family phage terminase large subunit | - |
| PZB81_RS08895 (PZB81_08895) | - | 1875124..1875549 (-) | 426 | WP_002493385.1 | terminase small subunit | - |
| PZB81_RS08900 (PZB81_08900) | - | 1875633..1876121 (-) | 489 | WP_002493386.1 | hypothetical protein | - |
| PZB81_RS08905 (PZB81_08905) | - | 1876431..1876847 (-) | 417 | WP_002493387.1 | hypothetical protein | - |
| PZB81_RS08910 (PZB81_08910) | - | 1876847..1877299 (-) | 453 | WP_002493388.1 | hypothetical protein | - |
| PZB81_RS08915 (PZB81_08915) | - | 1877305..1877445 (-) | 141 | WP_002493389.1 | hypothetical protein | - |
| PZB81_RS08920 (PZB81_08920) | - | 1877447..1877617 (-) | 171 | WP_002493390.1 | hypothetical protein | - |
| PZB81_RS08925 (PZB81_08925) | - | 1877623..1877835 (-) | 213 | WP_002493391.1 | DUF1381 domain-containing protein | - |
| PZB81_RS08930 (PZB81_08930) | - | 1877875..1878402 (-) | 528 | WP_002493392.1 | dUTP diphosphatase | - |
| PZB81_RS08935 (PZB81_08935) | - | 1878403..1878609 (-) | 207 | WP_002493393.1 | hypothetical protein | - |
| PZB81_RS08940 (PZB81_08940) | - | 1878602..1878946 (-) | 345 | WP_002493394.1 | hypothetical protein | - |
| PZB81_RS08945 (PZB81_08945) | - | 1878988..1879251 (-) | 264 | WP_002493395.1 | hypothetical protein | - |
| PZB81_RS08950 (PZB81_08950) | - | 1879241..1879450 (-) | 210 | WP_002493396.1 | hypothetical protein | - |
| PZB81_RS08955 (PZB81_08955) | - | 1879440..1879916 (-) | 477 | WP_002493397.1 | DUF3310 domain-containing protein | - |
| PZB81_RS08960 (PZB81_08960) | - | 1879913..1880272 (-) | 360 | WP_002493398.1 | SA1788 family PVL leukocidin-associated protein | - |
| PZB81_RS08965 (PZB81_08965) | - | 1880273..1880680 (-) | 408 | WP_002493399.1 | RusA family crossover junction endodeoxyribonuclease | - |
| PZB81_RS08970 (PZB81_08970) | - | 1880719..1881606 (-) | 888 | WP_002493400.1 | DnaD domain protein | - |
| PZB81_RS08975 (PZB81_08975) | ssbA | 1881636..1882106 (-) | 471 | WP_002493401.1 | single-stranded DNA-binding protein | Machinery gene |
| PZB81_RS08980 (PZB81_08980) | - | 1882107..1882736 (-) | 630 | WP_332829396.1 | MBL fold metallo-hydrolase | - |
| PZB81_RS08985 (PZB81_08985) | - | 1882805..1883740 (-) | 936 | WP_002493403.1 | RecT family recombinase | - |
| PZB81_RS08990 (PZB81_08990) | - | 1883742..1885694 (-) | 1953 | WP_002493404.1 | AAA family ATPase | - |
| PZB81_RS08995 (PZB81_08995) | - | 1885763..1885939 (-) | 177 | WP_002493405.1 | hypothetical protein | - |
| PZB81_RS09000 (PZB81_09000) | - | 1886005..1886214 (-) | 210 | WP_001830281.1 | hypothetical protein | - |
| PZB81_RS09005 (PZB81_09005) | - | 1886227..1886946 (-) | 720 | WP_002493406.1 | phage repressor protein | - |
| PZB81_RS09010 (PZB81_09010) | - | 1886996..1887235 (+) | 240 | WP_002475580.1 | hypothetical protein | - |
| PZB81_RS09015 (PZB81_09015) | - | 1887225..1887404 (-) | 180 | WP_002475588.1 | hypothetical protein | - |
| PZB81_RS09020 (PZB81_09020) | - | 1887418..1887657 (-) | 240 | WP_002493407.1 | helix-turn-helix transcriptional regulator | - |
| PZB81_RS09025 (PZB81_09025) | - | 1887851..1888180 (+) | 330 | WP_002493408.1 | helix-turn-helix transcriptional regulator | - |
| PZB81_RS09030 (PZB81_09030) | - | 1888192..1888653 (+) | 462 | WP_002493409.1 | ImmA/IrrE family metallo-endopeptidase | - |
| PZB81_RS09035 (PZB81_09035) | - | 1888883..1889191 (+) | 309 | WP_002493410.1 | hypothetical protein | - |
| PZB81_RS09040 (PZB81_09040) | - | 1889193..1889774 (+) | 582 | WP_002493411.1 | hypothetical protein | - |
| PZB81_RS09045 (PZB81_09045) | - | 1889837..1890886 (+) | 1050 | WP_002493412.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17451.15 Da Isoelectric Point: 4.7719
>NTDB_id=797398 PZB81_RS08975 WP_002493401.1 1881636..1882106(-) (ssbA) [Staphylococcus epidermidis strain N2]
MINRVVLVGRLTKDPEFRTTPNGVEVTNFTLAINRNFTNAQGEREADFINVITFRKQAVNVNEYLSKGKLAGVDGRIQSR
SYENQEGRRIFVTEVVADSVQFLEPKNSNGGQQDSYQQQTRAQQGQSRQQSNEPVGDNPFANANGPIDISDDDLPF
MINRVVLVGRLTKDPEFRTTPNGVEVTNFTLAINRNFTNAQGEREADFINVITFRKQAVNVNEYLSKGKLAGVDGRIQSR
SYENQEGRRIFVTEVVADSVQFLEPKNSNGGQQDSYQQQTRAQQGQSRQQSNEPVGDNPFANANGPIDISDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=797398 PZB81_RS08975 WP_002493401.1 1881636..1882106(-) (ssbA) [Staphylococcus epidermidis strain N2]
ATGATTAATAGAGTTGTATTAGTAGGAAGATTGACAAAAGATCCAGAGTTTAGAACTACGCCTAACGGTGTTGAAGTAAC
AAACTTCACACTAGCGATTAATCGTAATTTTACGAACGCACAAGGCGAACGTGAAGCAGATTTTATAAACGTTATAACTT
TCAGAAAGCAAGCTGTAAATGTAAACGAGTATTTATCTAAAGGAAAATTAGCAGGCGTTGATGGTCGTATTCAATCACGC
AGCTATGAAAATCAAGAAGGTCGTCGAATATTTGTGACTGAAGTTGTCGCAGATAGCGTTCAATTTCTTGAACCTAAAAA
TTCAAATGGTGGCCAACAAGACTCTTATCAACAACAAACAAGAGCTCAGCAAGGACAAAGCAGACAACAAAGCAATGAAC
CGGTTGGGGATAACCCGTTTGCAAACGCTAATGGTCCAATTGATATTAGTGATGACGATTTACCATTTTAA
ATGATTAATAGAGTTGTATTAGTAGGAAGATTGACAAAAGATCCAGAGTTTAGAACTACGCCTAACGGTGTTGAAGTAAC
AAACTTCACACTAGCGATTAATCGTAATTTTACGAACGCACAAGGCGAACGTGAAGCAGATTTTATAAACGTTATAACTT
TCAGAAAGCAAGCTGTAAATGTAAACGAGTATTTATCTAAAGGAAAATTAGCAGGCGTTGATGGTCGTATTCAATCACGC
AGCTATGAAAATCAAGAAGGTCGTCGAATATTTGTGACTGAAGTTGTCGCAGATAGCGTTCAATTTCTTGAACCTAAAAA
TTCAAATGGTGGCCAACAAGACTCTTATCAACAACAAACAAGAGCTCAGCAAGGACAAAGCAGACAACAAAGCAATGAAC
CGGTTGGGGATAACCCGTTTGCAAACGCTAATGGTCCAATTGATATTAGTGATGACGATTTACCATTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.382 |
100 |
0.647 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50 |
100 |
0.545 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
57.547 |
67.949 |
0.391 |
| ssb | Neisseria meningitidis MC58 |
34.104 |
100 |
0.378 |
| ssb | Neisseria gonorrhoeae MS11 |
34.104 |
100 |
0.378 |
| ssb | Vibrio cholerae strain A1552 |
33.908 |
100 |
0.378 |
| ssb | Glaesserella parasuis strain SC1401 |
33.333 |
100 |
0.378 |